Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (FAM3B rabbit polyclonal antibody. Western Blot analysis of FAM3B expression in mouse intestine.)

Rabbit anti-Human, Mouse FAM3B Polyclonal Antibody

FAM3B (Protein FAM3B, Cytokine-like Protein 2-21, Pancreatic-derived Factor, PANDER, UNQ320/PRO365, PRED44, C21orf76, C21orf11)

Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
FAM3B; Polyclonal Antibody; FAM3B (Protein FAM3B; Cytokine-like Protein 2-21; Pancreatic-derived Factor; PANDER; UNQ320/PRO365; PRED44; C21orf76; C21orf11); Anti -FAM3B (Protein FAM3B; anti-FAM3B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human FAM3B. Species Crossreactivity: mouse.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MRPLAGGLLKVVFVVFASLCAWYSGYLLAELIPDAPLSSAAYSIRSIGERPVLKAPVPKRQKCDHWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRNMKFRSSWVFIAAKGLELPSEIQREKINHSDAKNNRYSGWPAEIQIEGCIPKERS
Applicable Applications for anti-FAM3B antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human FAM3B, aa1-235 (NP_478066.3).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(FAM3B rabbit polyclonal antibody. Western Blot analysis of FAM3B expression in mouse intestine.)

Western Blot (WB) (FAM3B rabbit polyclonal antibody. Western Blot analysis of FAM3B expression in mouse intestine.)

Western Blot (WB)

(Western Blot analysis of FAM3B expression in transfected 293T cell line by FAM3B polyclonal antibody. Lane 1: FAM3B transfected lysate (26kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of FAM3B expression in transfected 293T cell line by FAM3B polyclonal antibody. Lane 1: FAM3B transfected lysate (26kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-FAM3B antibody
FAM3B has delayed effects on beta-cell function, inhibiting basal insulin secretion from a beta-cell line in a dose-dependent manner.
Product Categories/Family for anti-FAM3B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI Official Full Name
FAM3B
Protein Family

Uniprot Description

FAM3B: Induces apoptosis of alpha and beta cells in a dose- and time-dependent manner. Present in insulin secretory granules and likely cosecreted with insulin. Belongs to the FAM3 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; Secreted, signal peptide; Cytokine; Nuclear envelope; Apoptosis

Chromosomal Location of Human Ortholog: 21q22.3

Cellular Component: extracellular space; extracellular region

Molecular Function: cytokine activity

Biological Process: apoptosis; insulin secretion

Similar Products

Product Notes

The FAM3B (Catalog #AAA642076) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FAM3B (Protein FAM3B, Cytokine-like Protein 2-21, Pancreatic-derived Factor, PANDER, UNQ320/PRO365, PRED44, C21orf76, C21orf11) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's FAM3B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the FAM3B for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MRPLAGGLLK VVFVVFASLC AWYSGYLLAE LIPDAPLSSA AYSIRSIGER PVLKAPVPKR QKCDHWTPCP SDTYAYRLLS GGGRSKYAKI CFEDNLLMGE QLGNVARGIN IAIVNYVTGN VTATRCFDMY EGDNSGPMTK FIQSAAPKSL LFMVTYDDGS TRLNNDAKNA IEALGSKEIR NMKFRSSWVF IAAKGLELPS EIQREKINHS DAKNNRYSGW PAEIQIEGCI PKERS. It is sometimes possible for the material contained within the vial of "FAM3B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.