Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (35.64kD).)

Mouse anti-Human, Rat PHOX2A Monoclonal Antibody | anti-PHOX2A antibody

PHOX2A (Paired Mesoderm Homeobox Protein 2A, ARIX1 Homeodomain Protein, Aristaless Homeobox Protein Homolog, Paired-like Homeobox 2A, ARIX, PMX2A) (AP)

Gene Names
PHOX2A; ARIX; FEOM2; NCAM2; PMX2A; CFEOM2
Reactivity
Human, Rat
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PHOX2A; Monoclonal Antibody; PHOX2A (Paired Mesoderm Homeobox Protein 2A; ARIX1 Homeodomain Protein; Aristaless Homeobox Protein Homolog; Paired-like Homeobox 2A; ARIX; PMX2A) (AP); anti-PHOX2A antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4F6
Specificity
Recognizes human PHOX2A. Species Crossreactivity: rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-PHOX2A antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-90 from human PHOX2A (NP_005160) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MDYSYLNSYDSCVAAMEASAYGDFGACSQPGGFQYSPLRPAFPAAGPPCPALGSSNCALGALRDHQPAPYSAVPYKFFPEPSGLHEKRKQ
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.64kD).)

Western Blot (WB) (Western Blot detection against Immunogen (35.64kD).)

Western Blot (WB)

(PHOX2A monoclonal antibody Western Blot analysis of PHOX2A expression in PC-12.)

Western Blot (WB) (PHOX2A monoclonal antibody Western Blot analysis of PHOX2A expression in PC-12.)

Western Blot (WB)

(Western Blot analysis of PHOX2A expression in transfected 293T cell line by PHOX2A monoclonal antibody. Lane 1: PHOX2A transfected lysate (29.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PHOX2A expression in transfected 293T cell line by PHOX2A monoclonal antibody. Lane 1: PHOX2A transfected lysate (29.7kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PHOX2A on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to PHOX2A on HeLa cell. [antibody concentration 10ug/ml].)

Western Blot (WB)

(Western blot analysis of PHOX2A over-expressed 293 cell line, cotransfected with PHOX2A Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PHOX2A monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of PHOX2A over-expressed 293 cell line, cotransfected with PHOX2A Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with PHOX2A monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)
Product Categories/Family for anti-PHOX2A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
401
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29,653 Da
NCBI Official Full Name
paired mesoderm homeobox protein 2A
NCBI Official Synonym Full Names
paired-like homeobox 2a
NCBI Official Symbol
PHOX2A
NCBI Official Synonym Symbols
ARIX; FEOM2; NCAM2; PMX2A; CFEOM2
NCBI Protein Information
paired mesoderm homeobox protein 2A; arix homeodomain protein; ARIX1 homeodomain protein; aristaless homeobox homolog; aristaless homeobox protein homolog
UniProt Protein Name
Paired mesoderm homeobox protein 2A
UniProt Gene Name
PHOX2A
UniProt Synonym Gene Names
ARIX; PMX2A
UniProt Entry Name
PHX2A_HUMAN

NCBI Description

The protein encoded by this gene contains a paired-like homeodomain most similar to that of the Drosophila aristaless gene product. The encoded protein plays a central role in development of the autonomic nervous system. It regulates the expression of tyrosine hydroxylase and dopamine beta-hydroxylase, two catecholaminergic biosynthetic enzymes essential for the differentiation and maintenance of the noradrenergic neurotransmitter phenotype. The encoded protein has also been shown to regulate transcription of the alpha3 nicotinic acetylcholine receptor gene. Mutations in this gene have been associated with autosomal recessive congenital fibrosis of the extraocular muscles. [provided by RefSeq, Jul 2008]

Uniprot Description

PHOX2A: May be involved in regulating the specificity of expression of the catecholamine biosynthetic genes. Acts as a transcription activator/factor. Could maintain the noradrenergic phenotype. Defects in PHOX2A are the cause of congenital fibrosis of extraocular muscles type 2 (CFEOM2). CFEOM encompasses several different inherited strabismus syndromes characterized by congenital restrictive ophthalmoplegia affecting extraocular muscles innervated by the oculomotor and/or trochlear nerves. CFEOM is characterized clinically by anchoring of the eyes in downward gaze, ptosis, and backward tilt of the head. CFEOM2 may result from the aberrant development of the oculomotor (nIII), trochlear (nIV) and abducens (nVI) cranial nerve nuclei. Belongs to the paired homeobox family.

Protein type: Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 11q13.2

Cellular Component: nuclear chromatin

Molecular Function: transcription factor activity

Biological Process: sympathetic nervous system development; regulation of respiratory gaseous exchange; trochlear nerve formation; transcription, DNA-dependent; oculomotor nerve formation; somatic motor neuron differentiation; midbrain development; positive regulation of transcription from RNA polymerase II promoter; locus ceruleus development

Disease: Fibrosis Of Extraocular Muscles, Congenital, 2

Research Articles on PHOX2A

Similar Products

Product Notes

The PHOX2A phox2a (Catalog #AAA6132930) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PHOX2A (Paired Mesoderm Homeobox Protein 2A, ARIX1 Homeodomain Protein, Aristaless Homeobox Protein Homolog, Paired-like Homeobox 2A, ARIX, PMX2A) (AP) reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PHOX2A can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PHOX2A phox2a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PHOX2A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.