Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-F2RL2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human heart)

Rabbit F2RL2 Polyclonal Antibody | anti-F2RL2 antibody

F2RL2 antibody - C-terminal region

Gene Names
F2RL2; PAR3; PAR-3
Reactivity
Cow, Human, Pig
Applications
Western Blot
Purity
Affinity Purified
Synonyms
F2RL2; Polyclonal Antibody; F2RL2 antibody - C-terminal region; anti-F2RL2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Human, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HANYYYNNTDGLYFIYLIALCLGSLNSCLDPFLYFLMSKTRNHSTAYLTK
Sequence Length
374
Applicable Applications for anti-F2RL2 antibody
Western Blot (WB)
Homology
Cow: 77%; Human: 100%; Pig: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human F2RL2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-F2RL2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human heart)

Western Blot (WB) (WB Suggested Anti-F2RL2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human heart)
Related Product Information for anti-F2RL2 antibody
This is a rabbit polyclonal antibody against F2RL2. It was validated on Western Blot

Target Description: Coagulation factor II (thrombin) receptor-like 2 (F2RL2) is a member of the large family of 7-transmembrane-region receptors that couple to guanosine-nucleotide-binding proteins. F2RL2 is also a member of the protease-activated receptor family and activated by thrombin. F2RL2 is activated by proteolytic cleavage of its extracellular amino terminus. The new amino terminus functions as a tethered ligand and activates the receptor. F2RL2 is a cofactor for F2RL3 activation by thrombin. It mediates thrombin-triggered phosphoinositide hydrolysis and is expressed in a variety of tissues.
Product Categories/Family for anti-F2RL2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
proteinase-activated receptor 3 isoform 1
NCBI Official Synonym Full Names
coagulation factor II thrombin receptor like 2
NCBI Official Symbol
F2RL2
NCBI Official Synonym Symbols
PAR3; PAR-3
NCBI Protein Information
proteinase-activated receptor 3
UniProt Protein Name
Proteinase-activated receptor 3
UniProt Gene Name
F2RL2
UniProt Synonym Gene Names
PAR3; PAR-3
UniProt Entry Name
PAR3_HUMAN

NCBI Description

This gene encodes a member of the protease-activated receptor (PAR) family which is a subfamily of the seven transmembrane G protein-coupled cell surface receptor family. The encoded protein acts as a cofactor in the thrombin-mediated cleavage and activation of the protease-activated receptor family member PAR4. The encoded protein plays an essential role in hemostasis and thrombosis. Alternate splicing results in multiple transcript variants that encode different isoforms. [provided by RefSeq, Feb 2012]

Uniprot Description

PAR3: a G-protein coupled receptor for activated thrombin or trypsin. Coupled to G proteins that stimulate phosphoinositide hydrolysis. Interacts with INSC/inscuteable and probably GPSM2. Highest expression in the megakaryocytes of the bone marrow, lower in mature megakaryocytes, in platelets and in a variety of other tissues such as heart and gut.

Protein type: Membrane protein, multi-pass; Membrane protein, integral; GPCR, family 1; Receptor, GPCR

Chromosomal Location of Human Ortholog: 5q13

Cellular Component: integral to plasma membrane; apical plasma membrane; plasma membrane; extracellular region

Molecular Function: protein binding; phosphoinositide phospholipase C activity; thrombin receptor activity

Biological Process: platelet activation; metabolic process; response to wounding; blood coagulation

Research Articles on F2RL2

Similar Products

Product Notes

The F2RL2 f2rl2 (Catalog #AAA3214633) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The F2RL2 antibody - C-terminal region reacts with Cow, Human, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's F2RL2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the F2RL2 f2rl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HANYYYNNTD GLYFIYLIAL CLGSLNSCLD PFLYFLMSKT RNHSTAYLTK. It is sometimes possible for the material contained within the vial of "F2RL2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.