Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: F2RL3Sample Tissue: Human HT1080 Whole CellAntibody Dilution: 1ug/ml)

Rabbit anti-Human F2RL3 Polyclonal Antibody | anti-F2RL3 antibody

F2RL3 Antibody - C-terminal region

Gene Names
F2RL3; PAR4
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
F2RL3; Polyclonal Antibody; F2RL3 Antibody - C-terminal region; anti-F2RL3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LNSCVDPFIYYYVSAEFRDKVRAGLFQRSPGDTVASKASAEGGSRGMGTH
Sequence Length
385
Applicable Applications for anti-F2RL3 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human F2RL3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: F2RL3Sample Tissue: Human HT1080 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: F2RL3Sample Tissue: Human HT1080 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: F2RL3Sample Type: THP-1 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: F2RL3Sample Type: THP-1 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-F2RL3 antibody
This is a rabbit polyclonal antibody against F2RL3. It was validated on Western Blot

Target Description: Coagulation factor II (thrombin) receptor-like 3 (F2RL3) is a member of the large family of 7-transmembrane-region receptors that couple to guanosine-nucleotide-binding proteins. F2RL3 is also a member of the protease-activated receptor family. F2RL3 is activated by proteolytic cleavage of its extracellular amino terminus. The new amino terminus functions as a tethered ligand and activates the receptor. F2RL3 is activated by thrombin and trypsin.
Product Categories/Family for anti-F2RL3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
proteinase-activated receptor 4 preproprotein
NCBI Official Synonym Full Names
F2R like thrombin or trypsin receptor 3
NCBI Official Symbol
F2RL3
NCBI Official Synonym Symbols
PAR4
NCBI Protein Information
proteinase-activated receptor 4
UniProt Protein Name
Proteinase-activated receptor 4
UniProt Gene Name
F2RL3
UniProt Synonym Gene Names
PAR4; PAR-4
UniProt Entry Name
PAR4_HUMAN

NCBI Description

This gene encodes a member of the protease-activated receptor subfamily, part of the G-protein coupled receptor 1 family of proteins. The encoded receptor is proteolytically processed to reveal an extracellular N-terminal tethered ligand that binds to and activates the receptor. This receptor plays a role in blood coagulation, inflammation and response to pain. Hypomethylation at this gene may be associated with lung cancer in human patients. [provided by RefSeq, Sep 2016]

Uniprot Description

PAR4: a G-protein coupled receptor for activated thrombin or trypsin. Coupled to G proteins that stimulate phosphoinositide hydrolysis. Plays a role in platelets activation. Thrombin requires PAR4 for full spreading on a fibrinogen matrix. Widely expressed, with highest levels in lung, pancreas, thyroid, testis and small intestine. Not expressed in brain, kidney, spinal cord and peripheral blood leukocytes. Also detected in platelets. A proteolytic cleavage generates a new N-terminus that functions as a tethered ligand.

Protein type: GPCR, family 1; Membrane protein, integral; Membrane protein, multi-pass; Receptor, GPCR

Chromosomal Location of Human Ortholog: 19p12

Cellular Component: integral to plasma membrane; plasma membrane; extracellular region

Molecular Function: thrombin receptor activity

Biological Process: platelet activation; platelet dense granule organization and biogenesis; response to wounding; G-protein signaling, coupled to IP3 second messenger (phospholipase C activating); positive regulation of release of sequestered calcium ion into cytosol; blood coagulation; signal transduction

Research Articles on F2RL3

Similar Products

Product Notes

The F2RL3 f2rl3 (Catalog #AAA3217508) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The F2RL3 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's F2RL3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the F2RL3 f2rl3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LNSCVDPFIY YYVSAEFRDK VRAGLFQRSP GDTVASKASA EGGSRGMGTH. It is sometimes possible for the material contained within the vial of "F2RL3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.