Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: EXO1Sample Tissue: Human LN18 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human EXO1 Polyclonal Antibody | anti-EXO1 antibody

EXO1 Antibody - middle region

Gene Names
EXO1; HEX1; hExoI
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
EXO1; Polyclonal Antibody; EXO1 Antibody - middle region; anti-EXO1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ESEYGDQEGKRLVDTDVARNSSDDIPNNHIPGDHIPDKATVFTDEESYSF
Sequence Length
803
Applicable Applications for anti-EXO1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human EXO1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: EXO1Sample Tissue: Human LN18 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: EXO1Sample Tissue: Human LN18 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-EXO1 antibody
This gene encodes a protein with 5' to 3' exonuclease activity as well as an RNase H activity. It is similar to the Saccharomyces cerevisiae protein Exo1 which interacts with Msh2 and which is involved in mismatch repair and recombination. Alternative splicing of this gene results in three transcript variants encoding two different isoforms.
Product Categories/Family for anti-EXO1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
88 kDa
NCBI Official Full Name
exonuclease 1 isoform a
NCBI Official Synonym Full Names
exonuclease 1
NCBI Official Symbol
EXO1
NCBI Official Synonym Symbols
HEX1; hExoI
NCBI Protein Information
exonuclease 1
UniProt Protein Name
Exonuclease 1
Protein Family
UniProt Gene Name
EXO1
UniProt Synonym Gene Names
EXOI; HEX1; hExo1; hExoI
UniProt Entry Name
EXO1_HUMAN

NCBI Description

This gene encodes a protein with 5' to 3' exonuclease activity as well as an RNase H activity. It is similar to the Saccharomyces cerevisiae protein Exo1 which interacts with Msh2 and which is involved in mismatch repair and recombination. Alternative splicing of this gene results in three transcript variants encoding two different isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

EXO1: 5'->3' double-stranded DNA exonuclease which may also possess a cryptic 3'->5' double-stranded DNA exonuclease activity. Functions in DNA mismatch repair (MMR) to excise mismatch- containing DNA tracts directed by strand breaks located either 5' or 3' to the mismatch. Also exhibits endonuclease activity against 5'-overhanging flap structures similar to those generated by displacement synthesis when DNA polymerase encounters the 5'-end of a downstream Okazaki fragment. Required for somatic hypermutation (SHM) and class switch recombination (CSR) of immunoglobulin genes. Essential for male and female meiosis. Belongs to the XPG/RAD2 endonuclease family. EXO1 subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Hydrolase; EC 3.1.-.-

Chromosomal Location of Human Ortholog: 1q43

Cellular Component: nucleoplasm; nucleus

Molecular Function: 5'-3' exonuclease activity; protein binding; structure-specific DNA binding; double-stranded DNA specific 5'-3' exodeoxyribonuclease activity; DNA binding; single-stranded DNA specific 5'-3' exodeoxyribonuclease activity; 5'-3' exodeoxyribonuclease activity; metal ion binding; exonuclease activity; ribonuclease H activity; flap endonuclease activity

Biological Process: humoral immune response mediated by circulating immunoglobulin; mismatch repair; meiotic cell cycle; somatic hypermutation of immunoglobulin genes; isotype switching; DNA repair; DNA catabolic process, exonucleolytic; DNA catabolic process, endonucleolytic; DNA recombination

Research Articles on EXO1

Similar Products

Product Notes

The EXO1 exo1 (Catalog #AAA3221536) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EXO1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's EXO1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the EXO1 exo1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ESEYGDQEGK RLVDTDVARN SSDDIPNNHI PGDHIPDKAT VFTDEESYSF. It is sometimes possible for the material contained within the vial of "EXO1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.