Western Blot (WB)
(Host: RabbitTarget Name: ESRRBSample Tissue: Mouse Kidney lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Mouse ESRRB Polyclonal Antibody | anti-ESRRB antibody
ESRRB Antibody - middle region
Gene Names
Esrrb; Err2; Errb; Nr3b2; Estrrb
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
ESRRB; Polyclonal Antibody; ESRRB Antibody - middle region; anti-ESRRB antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DRVRGGRQKYKRRLDSENSPYLNLPISPPAKKPLTKIVSNLLGVEQDKLY
Sequence Length
433
Applicable Applications for anti-ESRRB antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse ESRRB
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: ESRRBSample Tissue: Mouse Kidney lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: ESRRBSample Tissue: Mouse Kidney lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-ESRRB antibody
Transcription factor that binds a canonical ESRRB recognition (ERRE) sequence 5'TCAAGGTCA-3' localized on promoter and enhancer of targets genes regulating their expression or their transcriptional activity. Plays a role, in a LIF-independent manner, in maintainance of self-renewal and pluripotency of embryonic and trophoblast stem cells through different signaling pathways including FGF signaling pathway and Wnt signaling pathways. Upon FGF signaling pathway activation, interacts with KDM1A by directly binding to enhancer site of ELF5 and EOMES and activating their transcription leading to self-renewal of trophoblast stem cells. Also regulates expression of multiple rod-specific genes and is required for survival of this cell type. Plays a role as transcription factor activator of GATA6, NR0B1, POU5F1 and PERM1. Plays a role as transcription factor repressor of NFE2L2 transcriptional activity and ESR1 transcriptional activity (By similarity). During mitosis remains bound to a subset of interphase target genes, including pluripotency regulators, through the canonical ESRRB recognition (ERRE) sequence, leading to their transcriptional activation in early G1 phase. Can coassemble on structured DNA elements with other transcription factors like SOX2, POU5F1, KDM1A and NCOA3 to trigger ESRRB-dependent gene activation. This mechanism, in the case of SOX2 corecruitment prevents the embryonic stem cells (ESCs) to epiblast stem cells (EpiSC) transition through positive regulation of NR0B1 that inhibits the EpiSC transcriptional program (PubMed:23169531). Also plays a role inner ear development by controlling expression of ion channels and transporters and in early placentation.
Product Categories/Family for anti-ESRRB antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47 kDa
NCBI Official Full Name
steroid hormone receptor ERR2 isoform 2
NCBI Official Synonym Full Names
estrogen related receptor, beta
NCBI Official Symbol
Esrrb
NCBI Official Synonym Symbols
Err2; Errb; Nr3b2; Estrrb
NCBI Protein Information
steroid hormone receptor ERR2
UniProt Protein Name
Steroid hormone receptor ERR2
Protein Family
UniProt Gene Name
Esrrb
UniProt Synonym Gene Names
Err-2; Err2; Nr3b2; ERR-beta
UniProt Entry Name
ERR2_MOUSE
Research Articles on ESRRB
Similar Products
Product Notes
The ESRRB esrrb (Catalog #AAA3223680) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ESRRB Antibody - middle region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's ESRRB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ESRRB esrrb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DRVRGGRQKY KRRLDSENSP YLNLPISPPA KKPLTKIVSN LLGVEQDKLY. It is sometimes possible for the material contained within the vial of "ESRRB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
