Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: HHEXSample Tissue: Mouse Skeletal Muscle lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Mouse HHEX Polyclonal Antibody | anti-HHEX antibody

HHEX Antibody - middle region

Gene Names
Hhex; Hex; Prh; Hex1; Prhx; Hhex-rs2
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
HHEX; Polyclonal Antibody; HHEX Antibody - middle region; anti-HHEX antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YLSPPERKRLAKMLQLSERQVKTWFQNRRAKWRRLKQENPQSNKKDALDS
Sequence Length
271
Applicable Applications for anti-HHEX antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse HHEX
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: HHEXSample Tissue: Mouse Skeletal Muscle lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: HHEXSample Tissue: Mouse Skeletal Muscle lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-HHEX antibody
Recognizes the DNA sequence 5'-ATTAA-3' (By similarity). Transcriptional repressor. May play a role in hematopoietic differentiation. Establishes anterior identity at two levels; acts early to enhance canonical WNT-signaling by repressing expression of TLE4, and acts later to inhibit NODAL-signaling by directly targeting NODAL.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29 kDa
NCBI Official Full Name
hematopoietically-expressed homeobox protein Hhex
NCBI Official Synonym Full Names
hematopoietically expressed homeobox
NCBI Official Symbol
Hhex
NCBI Official Synonym Symbols
Hex; Prh; Hex1; Prhx; Hhex-rs2
NCBI Protein Information
hematopoietically-expressed homeobox protein Hhex
UniProt Protein Name
Hematopoietically-expressed homeobox protein Hhex
UniProt Gene Name
Hhex
UniProt Synonym Gene Names
Prh; Prhx; Homeobox protein HEX; mHex
UniProt Entry Name
HHEX_MOUSE

Uniprot Description

HHEX: Recognizes the DNA sequence 5'-ATTAA-3'. Transcriptional repressor. May play a role in hematopoietic differentiation. Establishes anterior identity at two levels; acts early to enhance canonical WNT-signaling by repressing expression of TLE4, and acts later to inhibit NODAL-signaling by directly targeting NODAL.

Protein type: Transcription factor; DNA-binding

Cellular Component: cytoplasm; nucleus

Molecular Function: chromatin binding; DNA bending activity; DNA binding; eukaryotic initiation factor 4E binding; protein homodimerization activity; sequence-specific DNA binding; transcription factor activity; transcription factor binding

Biological Process: anterior/posterior pattern formation; B cell differentiation; cell differentiation; cell proliferation; embryonic heart tube development; embryonic organ development; endoderm development; forebrain development; forebrain morphogenesis; hemopoiesis; in utero embryonic development; interkinetic nuclear migration; liver development; morphogenesis of an epithelium; mRNA export from nucleus; multicellular organism growth; multicellular organismal development; myeloid leukocyte differentiation; negative regulation of angiogenesis; negative regulation of cyclin-dependent protein kinase activity; negative regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent; negative regulation of vascular endothelial growth factor receptor signaling pathway; Notch signaling pathway; organ morphogenesis; pancreas development; poly(A)+ mRNA export from nucleus; positive regulation of transcription from RNA polymerase II promoter; positive regulation of Wnt receptor signaling pathway; regulation of cell proliferation; regulation of transcription from RNA polymerase II promoter; regulation of transcription, DNA-dependent; signal transduction; thyroid gland development; tissue morphogenesis; transcription, DNA-dependent; vasculogenesis; Wnt receptor signaling pathway

Research Articles on HHEX

Similar Products

Product Notes

The HHEX hhex (Catalog #AAA3223652) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HHEX Antibody - middle region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's HHEX can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HHEX hhex for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YLSPPERKRL AKMLQLSERQ VKTWFQNRRA KWRRLKQENP QSNKKDALDS. It is sometimes possible for the material contained within the vial of "HHEX, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.