Rabbit ESRRB Polyclonal Antibody | anti-ESRRB antibody

ESRRB antibody - N-terminal region

Cat. Num. AAA3200828

• Gene Names: ESRRB; ERR2; ERRb; ESRL2; NR3B2; DFNB35
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
• Applications: Western Blot
• Purity: Affinity Purified
• Synonyms: ESRRB; Polyclonal Antibody; ESRRB antibody - N-terminal region; anti-ESRRB antibody

• Host: Rabbit
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: SSDASGGFGLALGTHANGLDSPPMFAGAGLGGTPCRKSYEDCASGIMEDS
• Sequence Length: 500

• Applicable Applications for anti-ESRRB antibody: Western Blot (WB)
• Homology: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ESRRB
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Sample Type: Mouse ES, fraction CV1Lanes :Lane 1: 25ug mouse ES cellsLane 2: 25ug mouse ES cells overexpressing DYKDDDDK EsrrB (mouse)Lane 3: 25ug chromatin fraction CV1 cellsLane 4: 25ug chromatin fraction CV1 cells overexpressing DYKDDDDK EsrrB (mouse)Lane 5: 25ug chromatin fraction CV1 cells overexpressing DYKDDDDK EsrrB-Deltacter (mouse)Primary Antibody Dilution :1:500Secondary Antibody :Anti-rabbit-HRPSecondary Antibody Dilution :1:3000Gene Name :ESRRBSubmitted by :Domenico Maiorano, Institute of Human Genetics (IGH))

Western Blot (WB)

(WB Suggested Anti-ESRRB Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysate)

Related Product Information for anti-ESRRB antibody

This is a rabbit polyclonal antibody against ESRRB. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ESRRB encodes a protein with similarity to the estrogen receptor. Its function is unknown; however, a similar protein in mouse plays an essential role in placental development. This gene encodes a protein with similarity to the estrogen receptor. Its function is unknown; however, a similar protein in mouse plays an essential role in placental development. Sequence Note: The sequence AF094517.1 is from a chimeric clone. Only the ESRRB sequence was propagated into this RefSeq record. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Product Categories/Family for anti-ESRRB antibody

Polyclonal; Transcription Factor; Transcription Regulation; Transcription Regulation; Developmental Biology; Receptors; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 238550159
• NCBI GeneID: 2103
• NCBI Accession #: NP_004443
• NCBI GenBank Nucleotide #: NM_004452
• UniProt Accession #: O95718
• Molecular Weight: 55kDa
• NCBI Official Full Name: steroid hormone receptor ERR2
• NCBI Official Synonym Full Names: estrogen related receptor beta
• NCBI Official Symbol: ESRRB
• NCBI Official Synonym Symbols: ERR2; ERRb; ESRL2; NR3B2; DFNB35
• NCBI Protein Information: steroid hormone receptor ERR2
• UniProt Protein Name: Steroid hormone receptor ERR2
• Protein Family: Steroid hormone receptor
• UniProt Gene Name: ESRRB
• UniProt Synonym Gene Names: ERRB2; ESRL2; NR3B2; ERR-beta
• UniProt Entry Name: ERR2_HUMAN

NCBI Description

This gene encodes a protein with similarity to the estrogen receptor. Its function is unknown; however, a similar protein in mouse plays an essential role in placental development. [provided by RefSeq, Jul 2008]

Uniprot Description

ERR2: Nuclear receptor, may regulate ESR1 transcriptional activity. Defects in ESRRB are the cause of deafness autosomal recessive type 35 (DFNB35). DFNB35 is a form of sensorineural hearing loss. Sensorineural deafness results from damage to the neural receptors of the inner ear, the nerve pathways to the brain, or the area of the brain that receives sound information. Belongs to the nuclear hormone receptor family. NR3 subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Nuclear receptor; Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 14q24.3

Cellular Component: nucleoplasm; nucleus

Molecular Function: ligand-dependent nuclear receptor activity; zinc ion binding; sequence-specific DNA binding; transcription coactivator activity; steroid hormone receptor activity; transcription factor binding; steroid binding

Biological Process: transcription initiation from RNA polymerase II promoter; embryonic placenta development; trophectodermal cell proliferation; intracellular receptor-mediated signaling pathway; regulation of transcription, DNA-dependent; stem cell maintenance; trophectodermal cellular morphogenesis; positive regulation of transcription from RNA polymerase II promoter; gene expression; steroid hormone mediated signaling

Disease: Deafness, Autosomal Recessive 35