Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ZNF259Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human ZPR1 Polyclonal Antibody | anti-ZPR1 antibody

ZPR1 Antibody - middle region

Gene Names
ZPR1; ZNF259
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
ZPR1; Polyclonal Antibody; ZPR1 Antibody - middle region; anti-ZPR1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VTKNPFTLGDSSNPGQTERLQEFSQKMDQIIEGNMKAHFIMDDPAGNSYL
Sequence Length
459
Applicable Applications for anti-ZPR1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ZNF259
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ZNF259Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ZNF259Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-ZPR1 antibody
The protein encoded by this gene is found in the cytoplasm of quiescent cells but translocates to the nucleolus in proliferating cells. The encoded protein interacts with survival motor neuron protein (SMN1) to enhance pre-mRNA splicing and to induce neuronal differentiation and axonal growth. Defects in this gene or the SMN1 gene can cause spinal muscular atrophy. Two transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50 kDa
NCBI Official Full Name
zinc finger protein ZPR1 isoform 1
NCBI Official Synonym Full Names
ZPR1 zinc finger
NCBI Official Symbol
ZPR1
NCBI Official Synonym Symbols
ZNF259
NCBI Protein Information
zinc finger protein ZPR1
UniProt Protein Name
Zinc finger protein ZPR1
Protein Family
UniProt Gene Name
ZPR1
UniProt Synonym Gene Names
ZNF259
UniProt Entry Name
ZPR1_HUMAN

NCBI Description

The protein encoded by this gene is found in the cytoplasm of quiescent cells but translocates to the nucleolus in proliferating cells. The encoded protein interacts with survival motor neuron protein (SMN1) to enhance pre-mRNA splicing and to induce neuronal differentiation and axonal growth. Defects in this gene or the SMN1 gene can cause spinal muscular atrophy. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2015]

Uniprot Description

ZNF259: May be a signaling molecule that communicates mitogenic signals from the cytoplasm to the nucleus. Binds to the EGF and PDGF receptors. Binds to the elongation factor 1-alpha EF1A. Component of an import snRNP complex composed of KPNB1, SNUPN, SMN1 and ZNF259. Belongs to the ZPR1 family.

Protein type: Nucleolus; Cell cycle regulation

Chromosomal Location of Human Ortholog: 11q23.3

Cellular Component: nucleoplasm; Cajal body; growth cone; cell soma; perinuclear region of cytoplasm; axon; cytoplasm; nucleolus; perikaryon; SMN complex; nucleus

Molecular Function: protein binding; zinc ion binding; translation initiation factor binding; receptor tyrosine kinase binding

Biological Process: cell proliferation; regulation of myelination; trophectodermal cell proliferation; positive regulation of protein import into nucleus; spinal cord development; RNA splicing; DNA endoreduplication; Cajal body organization and biogenesis; microtubule cytoskeleton organization and biogenesis; mRNA processing; signal transduction; positive regulation of RNA splicing; positive regulation of growth; inner cell mass cell proliferation

Research Articles on ZPR1

Similar Products

Product Notes

The ZPR1 zpr1 (Catalog #AAA3222267) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZPR1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ZPR1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ZPR1 zpr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VTKNPFTLGD SSNPGQTERL QEFSQKMDQI IEGNMKAHFI MDDPAGNSYL. It is sometimes possible for the material contained within the vial of "ZPR1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.