Western Blot (WB)
(Host: RabbitTarget Name: ERI2Sample Type: Human 721_BAntibody Dilution: 1.0ug/mlERI2 is supported by BioGPS gene expression data to be expressed in 721_B)
Rabbit ERI2 Polyclonal Antibody | anti-ERI2 antibody
ERI2 antibody - middle region
Gene Names
ERI2; EXOD1; ZGRF5
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ERI2; Polyclonal Antibody; ERI2 antibody - middle region; anti-ERI2 antibody
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LQEVGIEFSGREHSGLDDSRNTALLAWKMIRDGCVMKITRSLNKGPFLLP
Sequence Length
328
Applicable Applications for anti-ERI2 antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 92%; Goat: 77%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 75%; Zebrafish: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ERI2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: ERI2Sample Type: Human 721_BAntibody Dilution: 1.0ug/mlERI2 is supported by BioGPS gene expression data to be expressed in 721_B)
Western Blot (WB)
(Host: RabbitTarget Name: ERI2Sample Type: Human 721_BAntibody Dilution: 1.0ug/mlERI2 is supported by BioGPS gene expression data to be expressed in 721_B)
Western Blot (WB)
(Host: RabbitTarget Name: ERI2Sample Type: Human HepG2Antibody Dilution: 1.0ug/mlERI2 is supported by BioGPS gene expression data to be expressed in HepG2)
Western Blot (WB)
(Host: RabbitTarget Name: ERI2Sample Type: Human HepG2Antibody Dilution: 1.0ug/mlERI2 is supported by BioGPS gene expression data to be expressed in HepG2)
Western Blot (WB)
(WB Suggested Anti-ERI2 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)
Western Blot (WB)
(WB Suggested Anti-ERI2 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)
Related Product Information for anti-ERI2 antibody
This is a rabbit polyclonal antibody against EXOD1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: EXOD1 belongs to the EXOD1 family. It contains 1 exonuclease domain. EXOD1 is a member of a new subclass of exonucleases called the 3'hExo/ERI-1 subfamily of DEDDh nucleases.
Target Description: EXOD1 belongs to the EXOD1 family. It contains 1 exonuclease domain. EXOD1 is a member of a new subclass of exonucleases called the 3'hExo/ERI-1 subfamily of DEDDh nucleases.
Product Categories/Family for anti-ERI2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
ERI1 exoribonuclease 2 isoform 2
NCBI Official Synonym Full Names
ERI1 exoribonuclease family member 2
NCBI Official Symbol
ERI2
NCBI Official Synonym Symbols
EXOD1; ZGRF5
NCBI Protein Information
ERI1 exoribonuclease 2
UniProt Protein Name
ERI1 exoribonuclease 2
Protein Family
UniProt Gene Name
ERI2
UniProt Synonym Gene Names
EXOD1; KIAA1504
Research Articles on ERI2
Similar Products
Product Notes
The ERI2 eri2 (Catalog #AAA3210821) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ERI2 antibody - middle region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ERI2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ERI2 eri2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LQEVGIEFSG REHSGLDDSR NTALLAWKMI RDGCVMKITR SLNKGPFLLP. It is sometimes possible for the material contained within the vial of "ERI2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
