Western Blot (WB)
(Host: RabbitTarget Name: MFAP1Sample Type: 721_BAntibody Dilution: 1.0ug/mlMFAP1 is supported by BioGPS gene expression data to be expressed in 721_B)
Rabbit MFAP1 Polyclonal Antibody | anti-MFAP1 antibody
MFAP1 antibody - middle region
Gene Names
MFAP1; AMP
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MFAP1; Polyclonal Antibody; MFAP1 antibody - middle region; anti-MFAP1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TKYTHLVDQDTTSFDSAWGQESAQNTKFFKQKAAGVRDVFERPSAKKRKT
Sequence Length
439
Applicable Applications for anti-MFAP1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MFAP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: MFAP1Sample Type: 721_BAntibody Dilution: 1.0ug/mlMFAP1 is supported by BioGPS gene expression data to be expressed in 721_B)
Western Blot (WB)
(Host: RabbitTarget Name: MFAP1Sample Type: 721_BAntibody Dilution: 1.0ug/mlMFAP1 is supported by BioGPS gene expression data to be expressed in 721_B)
Western Blot (WB)
(WB Suggested Anti-MFAP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human brain)
Western Blot (WB)
(WB Suggested Anti-MFAP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human brain)
Related Product Information for anti-MFAP1 antibody
This is a rabbit polyclonal antibody against MFAP1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: MFAP1 is a component of the elastin-associated microfibrils.
Target Description: MFAP1 is a component of the elastin-associated microfibrils.
Product Categories/Family for anti-MFAP1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52kDa
NCBI Official Full Name
microfibrillar-associated protein 1
NCBI Official Synonym Full Names
microfibril associated protein 1
NCBI Official Symbol
MFAP1
NCBI Official Synonym Symbols
AMP
NCBI Protein Information
microfibrillar-associated protein 1
UniProt Protein Name
Microfibrillar-associated protein 1
Protein Family
UniProt Gene Name
MFAP1
UniProt Entry Name
MFAP1_HUMAN
Uniprot Description
MFAP1: an extracellular matrix protein. Component of the elastin-associated microfibrils.
Protein type: Spliceosome; RNA-binding
Chromosomal Location of Human Ortholog: 15q15.3
Cellular Component: microfibril; extracellular region
Molecular Function: protein binding
Biological Process: extracellular matrix organization and biogenesis
Research Articles on MFAP1
Similar Products
Product Notes
The MFAP1 mfap1 (Catalog #AAA3212908) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MFAP1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MFAP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MFAP1 mfap1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TKYTHLVDQD TTSFDSAWGQ ESAQNTKFFK QKAAGVRDVF ERPSAKKRKT. It is sometimes possible for the material contained within the vial of "MFAP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
