Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Sample Type :Human brain stem cellsPrimary Antibody Dilution :1:500Secondary Antibody :Goat anti-rabbit Alexa-Fluor 594Secondary Antibody Dilution :1:1000Color/Signal Descriptions :EIF3G: Red DAPI:BlueGene Name :EIF3GSubmitted by :Dr. Yuzhi Chen, University of Arkansas for Medical Science)

Rabbit EIF3G Polyclonal Antibody | anti-EIF3G antibody

EIF3G antibody - middle region

Gene Names
EIF3G; EIF3S4; EIF3-P42; eIF3-p44; eIF3-delta
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Applications
Immunohistochemistry, Immunoprecipitation, Western Blot
Purity
Affinity Purified
Synonyms
EIF3G; Polyclonal Antibody; EIF3G antibody - middle region; anti-EIF3G antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LRDGASRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISR
Sequence Length
320
Applicable Applications for anti-EIF3G antibody
Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Goat: 86%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human EIF3G
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Sample Type :Human brain stem cellsPrimary Antibody Dilution :1:500Secondary Antibody :Goat anti-rabbit Alexa-Fluor 594Secondary Antibody Dilution :1:1000Color/Signal Descriptions :EIF3G: Red DAPI:BlueGene Name :EIF3GSubmitted by :Dr. Yuzhi Chen, University of Arkansas for Medical Science)

Immunohistochemistry (IHC) (Sample Type :Human brain stem cellsPrimary Antibody Dilution :1:500Secondary Antibody :Goat anti-rabbit Alexa-Fluor 594Secondary Antibody Dilution :1:1000Color/Signal Descriptions :EIF3G: Red DAPI:BlueGene Name :EIF3GSubmitted by :Dr. Yuzhi Chen, University of Arkansas for Medical Science)

Immunoprecipitation (IP)

(Sample Type: Mouse brainAmount and Sample Type :500 ug mouse brain homogenateAmount of IP Antibody :6 ugPrimary Antibody :EIF3GPrimary Antibody Dilution :1:500Secondary Antibody :Goat anti-rabbit Alexa-Fluor 594Secondary Antibody Dilution :1:5000Gene Name :EIF3GSubmitted by :Dr. Yuzhi Chen, University of Arkansas for Medical Science)

Immunoprecipitation (IP) (Sample Type: Mouse brainAmount and Sample Type :500 ug mouse brain homogenateAmount of IP Antibody :6 ugPrimary Antibody :EIF3GPrimary Antibody Dilution :1:500Secondary Antibody :Goat anti-rabbit Alexa-Fluor 594Secondary Antibody Dilution :1:5000Gene Name :EIF3GSubmitted by :Dr. Yuzhi Chen, University of Arkansas for Medical Science)

Western Blot (WB)

(Host: RabbitTarget Name: EIF3GSample Type: 293TAntibody Dilution: 1.0ug/mlEIF3G is supported by BioGPS gene expression data to be expressed in HEK293T)

Western Blot (WB) (Host: RabbitTarget Name: EIF3GSample Type: 293TAntibody Dilution: 1.0ug/mlEIF3G is supported by BioGPS gene expression data to be expressed in HEK293T)

Western Blot (WB)

(Host: RabbitTarget Name: EIF3GSample Type: MCF7Antibody Dilution: 1.0ug/mlEIF3G is supported by BioGPS gene expression data to be expressed in MCF7)

Western Blot (WB) (Host: RabbitTarget Name: EIF3GSample Type: MCF7Antibody Dilution: 1.0ug/mlEIF3G is supported by BioGPS gene expression data to be expressed in MCF7)

Western Blot (WB)

(WB Suggested Anti-EIF3G Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-EIF3G Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)
Related Product Information for anti-EIF3G antibody
This is a rabbit polyclonal antibody against EIF3G. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: EIF3G belongs to the eIF-3 subunit G family. It is a component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis.
Product Categories/Family for anti-EIF3G antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
eukaryotic translation initiation factor 3 subunit G
NCBI Official Synonym Full Names
eukaryotic translation initiation factor 3 subunit G
NCBI Official Symbol
EIF3G
NCBI Official Synonym Symbols
EIF3S4; EIF3-P42; eIF3-p44; eIF3-delta
NCBI Protein Information
eukaryotic translation initiation factor 3 subunit G
UniProt Protein Name
Eukaryotic translation initiation factor 3 subunit G
UniProt Gene Name
EIF3G
UniProt Entry Name
EIF3G_HUMAN

NCBI Description

This gene encodes a core subunit of the eukaryotic translation initiation factor 3 (eIF3) complex, which is required for initiation of protein translation. An N-terminal caspase cleavage product of the encoded protein may stimulate degradation of DNA. A mutation in this gene is associated with narcolepsy. [provided by RefSeq, Jul 2016]

Uniprot Description

eIF3-delta: eukaryotic translation initiation factor 3 subunit 4. Binds to the 40S ribosome and promotes the binding of methionyl-tRNAi and mRNA. This subunit binds to the 18S rRNA. eIF-3 is composed of at least 12 different subunits. Contains 1 RNA recognition motif (RRM) domain.

Protein type: RNA-binding; Translation; Translation initiation

Chromosomal Location of Human Ortholog: 19p13.2

Cellular Component: eukaryotic translation initiation factor 3 complex; perinuclear region of cytoplasm; cytoplasm; cytosol; nucleus

Molecular Function: protein binding; translation initiation factor activity; nucleotide binding

Biological Process: cellular protein metabolic process; translation; translational initiation; gene expression; formation of translation preinitiation complex; regulation of translational initiation

Research Articles on EIF3G

Similar Products

Product Notes

The EIF3G eif3g (Catalog #AAA3205265) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EIF3G antibody - middle region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's EIF3G can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blot (WB). Researchers should empirically determine the suitability of the EIF3G eif3g for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LRDGASRRGE SMQPNRRADD NATIRVTNLS EDTRETDLQE LFRPFGSISR. It is sometimes possible for the material contained within the vial of "EIF3G, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.