Rabbit PSMC5 Polyclonal Antibody | anti-PSMC5 antibody

PSMC5 antibody - C-terminal region

Cat. Num. AAA3203952

• Gene Names: PSMC5; S8; p45; SUG1; SUG-1; TBP10; TRIP1; p45/SUG
• Reactivity: Human , Mouse; Predicted Species Reactivity:Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
• Applications: Immunohistochemistry, Immunoprecipitation, Western Blot
• Purity: Protein A purified
• Synonyms: PSMC5; Polyclonal Antibody; PSMC5 antibody - C-terminal region; anti-PSMC5 antibody

• Host: Rabbit
• Reactivity: Human , Mouse; Predicted Species Reactivity:Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
• Clonality: Polyclonal
• Purity/Purification: Protein A purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: AEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK
• Sequence Length: 406

• Applicable Applications for anti-PSMC5 antibody: Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blot (WB)
• Homology: Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PSMC5
• Protein Size (# AA): 406 amino acids
• Subunit: 8
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Sample Type :Human brain stem cellsPrimary Antibody Dilution :1:500Secondary Antibody :Goat anti-rabbit Alexa-Fluor 594Secondary Antibody Dilution :1:1000Color/Signal Descriptions :PSMC5: Red DAPI:BlueGene Name :PSMC5Submitted by :Dr. Yuzhi Chen, University of Arkansas for Medical Science)

Immunoprecipitation (IP)

(Sample Type: Mouse brainAmount and Sample Type :500 ug mouse brain homogenateAmount of IP Antibody :6 ugPrimary Antibody :PSMC5Primary Antibody Dilution :1:500Secondary Antibody :Goat anti-rabbit Alexa-Fluor 594Secondary Antibody Dilution :1:5000Gene Name :PSMC5Submitted by :Dr. Yuzhi Chen, University of Arkansas for Medical Science)

Western Blot (WB)

(Sample Type: Mouse BrainSample Type:4. rat brain extract(80ug) Primary Antibody Dilution:2ug/ml Secondary Antibody: IRDye 800CW goat anti-rabbit from Li-COR Bioscience Secondary Antibody Dilution:1: 20,000 Image Submitted by: Yuzhi Chen University of Arkansas for Medical Science)

Western Blot (WB)

(WB Suggested Anti-PSMC5 Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)

Related Product Information for anti-PSMC5 antibody

This is a rabbit polyclonal antibody against PSMC5. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits.PSMC5 is one of the ATPase subunits, a member of the triple-A family of ATPases which have a chaperone-like activity. In addition to participation in proteasome functions, this subunit may participate in transcriptional regulation since it has been shown to interact with the thyroid hormone receptor and retinoid X receptor-alpha.

Product Categories/Family for anti-PSMC5 antibody

Polyclonal; Transcription Regulation; Drugs and Drug Metabolism; Immunohistochemistry; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 24497435
• NCBI GeneID: 5705
• NCBI Accession #: NP_002796
• NCBI GenBank Nucleotide #: NM_002805
• UniProt Accession #: P62195
• Molecular Weight: 46kDa
• NCBI Official Full Name: 26S proteasome regulatory subunit 8 isoform 1
• NCBI Official Synonym Full Names: proteasome 26S subunit, ATPase 5
• NCBI Official Symbol: PSMC5
• NCBI Official Synonym Symbols: S8; p45; SUG1; SUG-1; TBP10; TRIP1; p45/SUG
• NCBI Protein Information: 26S proteasome regulatory subunit 8
• UniProt Protein Name: 26S protease regulatory subunit 8
• UniProt Gene Name: PSMC5
• UniProt Synonym Gene Names: SUG1; TRIP1
• UniProt Entry Name: PRS8_HUMAN

NCBI Description

The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes one of the ATPase subunits, a member of the triple-A family of ATPases which have a chaperone-like activity. In addition to participation in proteasome functions, this subunit may participate in transcriptional regulation since it has been shown to interact with the thyroid hormone receptor and retinoid X receptor-alpha. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2010]

Uniprot Description

RPT6: The 26S protease is involved in the ATP-dependent degradation of ubiquitinated proteins. The regulatory (or ATPase) complex confers ATP dependency and substrate specificity to the 26S complex. Belongs to the AAA ATPase family.

Protein type: Nuclear receptor co-regulator; Proteasome complex; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 17q23.3

Cellular Component: nucleoplasm; proteasome complex; membrane; proteasome regulatory particle; cytoplasm; inclusion body; cytoplasmic vesicle; nucleus; cytosol

Molecular Function: thyrotropin-releasing hormone receptor binding; protein binding; TATA-binding protein binding; ATPase activity; transcription cofactor activity; transcription factor binding; ATP binding

Biological Process: positive regulation of ubiquitin-protein ligase activity during mitotic cell cycle; transcription from RNA polymerase II promoter; proteasomal ubiquitin-dependent protein catabolic process; negative regulation of ubiquitin-protein ligase activity during mitotic cell cycle; protein polyubiquitination; viral reproduction; apoptosis; positive regulation of transcription, DNA-dependent; antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent; DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest; regulation of apoptosis; antigen processing and presentation of peptide antigen via MHC class I; regulation of ubiquitin-protein ligase activity during mitotic cell cycle; anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process; negative regulation of programmed cell death; antigen processing and presentation of exogenous peptide antigen via MHC class I; gene expression; mitotic cell cycle; regulation of amino acid metabolic process; negative regulation of transcription, DNA-dependent; G1/S transition of mitotic cell cycle; negative regulation of apoptosis