Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-VIM AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Ovary TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit VIM Polyclonal Antibody | anti-VIM antibody

VIM antibody - N-terminal region

Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
VIM; Polyclonal Antibody; VIM antibody - N-terminal region; anti-VIM antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LNDRFANYIDKVRFLEQQNKILLAELEQLKGQGKSRLGDLYEEEMRELRR
Sequence Length
466
Applicable Applications for anti-VIM antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human VIM
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-VIM AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Ovary TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC) (Rabbit Anti-VIM AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Ovary TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC)

(Sample Type :Human brain stem cellsPrimary Antibody Dilution :1:500Secondary Antibody :Goat anti-rabbit Alexa-Fluor 594Secondary Antibody Dilution :1:1000Color/Signal Descriptions :VIM: Red DAPI:BlueGene Name :VIMSubmitted by :Dr. Yuzhi Chen, University of Arkansas for Medical Science)

Immunohistochemistry (IHC) (Sample Type :Human brain stem cellsPrimary Antibody Dilution :1:500Secondary Antibody :Goat anti-rabbit Alexa-Fluor 594Secondary Antibody Dilution :1:1000Color/Signal Descriptions :VIM: Red DAPI:BlueGene Name :VIMSubmitted by :Dr. Yuzhi Chen, University of Arkansas for Medical Science)

Immunohistochemistry (IHC)

(submitted by:Carl LundinStanford UniversityThe Vimentin antibody works well for visualization of the vimentin cytoskeleton (see attached images). We used PFA-fixed COS-7 cells and an antibody dilution of 1:400.)

Immunohistochemistry (IHC) (submitted by:Carl LundinStanford UniversityThe Vimentin antibody works well for visualization of the vimentin cytoskeleton (see attached images). We used PFA-fixed COS-7 cells and an antibody dilution of 1:400.)

Western Blot (WB)

(Host: MouseTarget Name: VIMSample Tissue: Mouse Small IntestineAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: MouseTarget Name: VIMSample Tissue: Mouse Small IntestineAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-VIM Antibody Titration: 0.2-1 ug/mlPositive Control: Human brain)

Western Blot (WB) (WB Suggested Anti-VIM Antibody Titration: 0.2-1 ug/mlPositive Control: Human brain)
Related Product Information for anti-VIM antibody
This is a rabbit polyclonal antibody against VIM. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Along with the microfilaments (actins) and microtubules (tubulins), the intermediate filaments represent a third class of well-characterized cytoskeletal elements. The subunits display a tissue-specific pattern of expression. Desmin is the subunit specific for muscle and vimentin the subunit specific for mesenchymal tissue.Along with the microfilaments (actins) and microtubules (tubulins), the intermediate filaments represent a third class of well-characterized cytoskeletal elements. The subunits display a tissue-specific pattern of expression. Desmin (MIM 125660) is the subunit specific for muscle and vimentin the subunit specific for mesenchymal tissue.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-VIM antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54kDa
NCBI Official Full Name
vimentin
NCBI Official Synonym Full Names
vimentin
NCBI Official Symbol
VIM
NCBI Protein Information
vimentin
UniProt Protein Name
Vimentin
Protein Family
UniProt Gene Name
VIM
UniProt Entry Name
VIME_HUMAN

NCBI Description

This gene encodes a type III intermediate filament protein. Intermediate filaments, along with microtubules and actin microfilaments, make up the cytoskeleton. The encoded protein is responsible for maintaining cell shape and integrity of the cytoplasm, and stabilizing cytoskeletal interactions. This protein is involved in neuritogenesis and cholesterol transport and functions as an organizer of a number of other critical proteins involved in cell attachment, migration, and signaling. Bacterial and viral pathogens have been shown to attach to this protein on the host cell surface. Mutations in this gene are associated with congenital cataracts in human patients. [provided by RefSeq, Aug 2017]

Uniprot Description

Vimentin: an intermediate filament protein. Intermediate filament proteins are expressed in a tissue-specific manner. Desmin is the subunit specific for muscle and vimentin the subunit specific for mesenchymal tissue.

Protein type: Cytoskeletal; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 10p13

Cellular Component: intermediate filament cytoskeleton; neuron projection; focal adhesion; cytoskeleton; cytoplasm; leading edge; plasma membrane; intermediate filament; peroxisome; cytosol

Molecular Function: protein C-terminus binding; identical protein binding; protein binding; structural constituent of cytoskeleton; double-stranded RNA binding; glycoprotein binding; structural constituent of eye lens

Biological Process: Bergmann glial cell differentiation; viral reproduction; apoptosis; intermediate filament organization; cell motility; astrocyte development; cell structure disassembly during apoptosis; muscle filament sliding

Disease: Cataract 30

Research Articles on VIM

Similar Products

Product Notes

The VIM vim (Catalog #AAA3208929) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The VIM antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's VIM can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the VIM vim for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LNDRFANYID KVRFLEQQNK ILLAELEQLK GQGKSRLGDL YEEEMRELRR. It is sometimes possible for the material contained within the vial of "VIM, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.