<
Immunohistochemistry (IHC)
(Human Thyroid)
Rabbit EHD4 Polyclonal Antibody | anti-EHD4 antibody
EHD4 antibody - middle region
Gene Names
EHD4; PAST4
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
EHD4; Polyclonal Antibody; EHD4 antibody - middle region; anti-EHD4 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LMNLISQEETSTPTQLVQGGAFDGTTEGPFNQGYGEGAKEGADEEEWVVA
Sequence Length
541
Applicable Applications for anti-EHD4 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human EHD4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(Human Thyroid)
Immunohistochemistry (IHC)
(Human Thyroid)
Immunohistochemistry (IHC)
(Immunohistochemistry with Human Thyroid lysate tissue at an antibody concentration of 5.0ug/ml using anti-EHD4 antibody )
Immunohistochemistry (IHC)
(Immunohistochemistry with Human Thyroid lysate tissue at an antibody concentration of 5.0ug/ml using anti-EHD4 antibody )
Western Blot (WB)
(Host: RabbitTarget Name: EHD4Sample Tissue: Human 786-0Antibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: EHD4Sample Tissue: Human 786-0Antibody Dilution: 1.0ug/ml)
Western Blot (WB)
(WB Suggested Anti-EHD4 Antibody Titration: 1 ug/mlPositive Control: Fetal Lung cell lysate)
Western Blot (WB)
(WB Suggested Anti-EHD4 Antibody Titration: 1 ug/mlPositive Control: Fetal Lung cell lysate)
Related Product Information for anti-EHD4 antibody
This is a rabbit polyclonal antibody against EHD4. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: EHD4 is involved in the control of trafficking at the early endosome and regulates exit of cargo toward both the recycling compartment and the late endocytic pathway.
Target Description: EHD4 is involved in the control of trafficking at the early endosome and regulates exit of cargo toward both the recycling compartment and the late endocytic pathway.
Product Categories/Family for anti-EHD4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61kDa
NCBI Official Full Name
EH domain-containing protein 4
NCBI Official Synonym Full Names
EH domain containing 4
NCBI Official Symbol
EHD4
NCBI Official Synonym Symbols
PAST4
NCBI Protein Information
EH domain-containing protein 4
UniProt Protein Name
EH domain-containing protein 4
Protein Family
UniProt Gene Name
EHD4
UniProt Synonym Gene Names
HCA10; HCA11; PAST4
UniProt Entry Name
EHD4_HUMAN
Research Articles on EHD4
Similar Products
Product Notes
The EHD4 ehd4 (Catalog #AAA3212223) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EHD4 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's EHD4 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the EHD4 ehd4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LMNLISQEET STPTQLVQGG AFDGTTEGPF NQGYGEGAKE GADEEEWVVA. It is sometimes possible for the material contained within the vial of "EHD4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
