Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Sample Type: Human HeartAnti-POSTN / Periostin antibody IHC staining of human heart. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.)

Rabbit POSTN Polyclonal Antibody | anti-POSTN antibody

POSTN antibody - middle region

Gene Names
POSTN; PN; OSF2; OSF-2; PDLPOSTN
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
POSTN; Polyclonal Antibody; POSTN antibody - middle region; anti-POSTN antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VTKFIEGGDGHLFEDEEIKRLLQGDTPVRKLQANKKVQGSRRRLREGRSQ
Sequence Length
836
Applicable Applications for anti-POSTN antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human POSTN
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Sample Type: Human HeartAnti-POSTN / Periostin antibody IHC staining of human heart. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.)

Immunohistochemistry (IHC) (Sample Type: Human HeartAnti-POSTN / Periostin antibody IHC staining of human heart. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.)

Immunohistochemistry (IHC)

(Sample Type: Human UterusAnti-POSTN / Periostin antibody IHC staining of human uterus. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.)

Immunohistochemistry (IHC) (Sample Type: Human UterusAnti-POSTN / Periostin antibody IHC staining of human uterus. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.)

Immunohistochemistry (IHC)

(Rabbit Anti-POSTN AntibodyParaffin Embedded Tissue: Human UterusAntibody Concentration: 5 ug/ml)

Immunohistochemistry (IHC) (Rabbit Anti-POSTN AntibodyParaffin Embedded Tissue: Human UterusAntibody Concentration: 5 ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: POSTNSample Tissue: Human A549 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: POSTNSample Tissue: Human A549 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: POSTNSample Tissue: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: POSTNSample Tissue: Human Fetal LungAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-POSTN AntibodyTitration: 1 ug/mlPositive Control: 293T cells lysate)

Western Blot (WB) (WB Suggested Anti-POSTN AntibodyTitration: 1 ug/mlPositive Control: 293T cells lysate)
Related Product Information for anti-POSTN antibody
This is a rabbit polyclonal antibody against POSTN. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: POSTN binds to heparin. It induces cell attachment and spreading and plays a role in cell adhesion. POSTN may play a role in extracellular matrix mineralization.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
93kDa
NCBI Official Full Name
periostin isoform 1
NCBI Official Synonym Full Names
periostin
NCBI Official Symbol
POSTN
NCBI Official Synonym Symbols
PN; OSF2; OSF-2; PDLPOSTN
NCBI Protein Information
periostin
UniProt Protein Name
Periostin
Protein Family
UniProt Gene Name
POSTN
UniProt Synonym Gene Names
OSF2; PN; OSF-2
UniProt Entry Name
POSTN_HUMAN

NCBI Description

This gene encodes a secreted extracellular matrix protein that functions in tissue development and regeneration, including wound healing, and ventricular remodeling following myocardial infarction. The encoded protein binds to integrins to support adhesion and migration of epithelial cells. This protein plays a role in cancer stem cell maintenance and metastasis. Mice lacking this gene exhibit cardiac valve disease, and skeletal and dental defects. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Sep 2015]

Uniprot Description

POSTN: Binds to heparin. Induces cell attachment and spreading and plays a role in cell adhesion. May play a role in extracellular matrix mineralization. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Secreted; Cell adhesion; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 13q13.3

Cellular Component: extracellular matrix; proteinaceous extracellular matrix; extracellular space; trans-Golgi network

Molecular Function: heparin binding; protein binding; cell adhesion molecule binding

Biological Process: tissue development; extracellular matrix organization and biogenesis; regulation of Notch signaling pathway; cell adhesion; skeletal development

Research Articles on POSTN

Similar Products

Product Notes

The POSTN postn (Catalog #AAA3205919) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The POSTN antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's POSTN can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the POSTN postn for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VTKFIEGGDG HLFEDEEIKR LLQGDTPVRK LQANKKVQGS RRRLREGRSQ. It is sometimes possible for the material contained within the vial of "POSTN, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.