Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-EARS2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysate)

Rabbit EARS2 Polyclonal Antibody | anti-EARS2 antibody

EARS2 antibody - middle region

Gene Names
EARS2; MSE1; gluRS; COXPD12
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
EARS2; Polyclonal Antibody; EARS2 antibody - middle region; anti-EARS2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TAKHLLLYQALGWQPPHFAHLPLLLNRDGSKLSKRQGDVFLEHFAADGFL
Sequence Length
523
Applicable Applications for anti-EARS2 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 86%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 100%; Yeast: 91%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human EARS2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-EARS2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysate)

Western Blot (WB) (WB Suggested Anti-EARS2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysate)
Related Product Information for anti-EARS2 antibody
This is a rabbit polyclonal antibody against EARS2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: EARS2 belongs to the class-I aminoacyl-tRNA synthetase family. The function of the EARS2 protein is not known.
Product Categories/Family for anti-EARS2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59kDa
NCBI Official Full Name
probable glutamate--tRNA ligase, mitochondrial isoform 1
NCBI Official Synonym Full Names
glutamyl-tRNA synthetase 2, mitochondrial
NCBI Official Symbol
EARS2
NCBI Official Synonym Symbols
MSE1; gluRS; COXPD12
NCBI Protein Information
probable glutamate--tRNA ligase, mitochondrial
UniProt Protein Name
EARS2 protein
UniProt Gene Name
EARS2
UniProt Entry Name
Q86YH3_HUMAN

NCBI Description

This gene encodes a member of the class I family of aminoacyl-tRNA synthetases. These enzymes play a critical role in protein biosynthesis by charging tRNAs with their cognate amino acids. This protein is encoded by the nuclear genome but is likely to be imported to the mitochondrion where it is thought to catalyze the ligation of glutamate to tRNA molecules. Mutations in this gene have been associated with combined oxidative phosphorylation deficiency 12 (COXPD12). Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2015]

Uniprot Description

EARS2: Catalyzes the attachment of glutamate to tRNA(Glu) in a two-step reaction: glutamate is first activated by ATP to form Glu-AMP and then transferred to the acceptor end of tRNA(Glu). Belongs to the class-I aminoacyl-tRNA synthetase family.

Protein type: Translation; Mitochondrial; Cofactor and Vitamin Metabolism - porphyrin and chlorophyll; EC 6.1.1.17; Ligase

Chromosomal Location of Human Ortholog: 16p12.2

Cellular Component: mitochondrion; mitochondrial matrix

Molecular Function: glutamate-tRNA(Gln) ligase activity; glutamate-tRNA ligase activity; ATP binding; tRNA binding

Biological Process: tRNA aminoacylation for protein translation; glutamyl-tRNA aminoacylation; gene expression

Disease: Combined Oxidative Phosphorylation Deficiency 12

Research Articles on EARS2

Similar Products

Product Notes

The EARS2 ears2 (Catalog #AAA3210488) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EARS2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's EARS2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the EARS2 ears2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TAKHLLLYQA LGWQPPHFAH LPLLLNRDGS KLSKRQGDVF LEHFAADGFL. It is sometimes possible for the material contained within the vial of "EARS2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.