Western Blot (WB)
(WB Suggested Anti-HORMAD2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Placenta)
Rabbit HORMAD2 Polyclonal Antibody | anti-HORMAD2 antibody
HORMAD2 antibody - middle region
Gene Names
HORMAD2; CT46.2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
HORMAD2; Polyclonal Antibody; HORMAD2 antibody - middle region; anti-HORMAD2 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YTDPMGSEKVTEMYQFKFKYTKEGATMDFDSHSSSTSFESGTNNEDIKKA
Sequence Length
307
Applicable Applications for anti-HORMAD2 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 92%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 86%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human HORMAD2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-HORMAD2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Placenta)
Western Blot (WB)
(WB Suggested Anti-HORMAD2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Placenta)
Related Product Information for anti-HORMAD2 antibody
This is a rabbit polyclonal antibody against HORMAD2. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: The specific function of the protein remains unknown.
Target Description: The specific function of the protein remains unknown.
Product Categories/Family for anti-HORMAD2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
HORMA domain-containing protein 2 isoform a
NCBI Official Synonym Full Names
HORMA domain containing 2
NCBI Official Symbol
HORMAD2
NCBI Official Synonym Symbols
CT46.2
NCBI Protein Information
HORMA domain-containing protein 2
UniProt Protein Name
HORMA domain-containing protein 2
Protein Family
UniProt Gene Name
HORMAD2
Uniprot Description
Essential for synapsis surveillance during meiotic prophase via the recruitment of ATR activity. Plays a key role in the male mid-pachytene checkpoint and the female meiotic prophase checkpoint: required for efficient build-up of ATR activity on unsynapsed chromosome regions, a process believed to form the basis of meiotic silencing of unsynapsed chromatin (MSUC) and meiotic prophase quality control in both sexes. Required for the DNA double-strand break-independent, BRCA1-dependent activation of ATR on the sex chromosomes that is essential for normal sex body formation ().
Research Articles on HORMAD2
Similar Products
Product Notes
The HORMAD2 hormad2 (Catalog #AAA3211088) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HORMAD2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HORMAD2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HORMAD2 hormad2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YTDPMGSEKV TEMYQFKFKY TKEGATMDFD SHSSSTSFES GTNNEDIKKA. It is sometimes possible for the material contained within the vial of "HORMAD2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
