Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-DYNLL1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Transfected 293T)

Rabbit DYNLL1 Polyclonal Antibody | anti-DYNLL1 antibody

DYNLL1 antibody - middle region

Gene Names
DYNLL1; LC8; PIN; DLC1; DLC8; LC8a; DNCL1; hdlc1; DNCLC1
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DYNLL1; Polyclonal Antibody; DYNLL1 antibody - middle region; anti-DYNLL1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAIL
Sequence Length
89
Applicable Applications for anti-DYNLL1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human DYNLL1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-DYNLL1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Transfected 293T)

Western Blot (WB) (WB Suggested Anti-DYNLL1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Transfected 293T)
Related Product Information for anti-DYNLL1 antibody
This is a rabbit polyclonal antibody against DYNLL1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Cytoplasmic dyneins are large enzyme complexes with a molecular mass of about 1,200 kD. They contain two force-producing heads formed primarily from dynein heavy chains, and stalks linking the heads to a basal domain, which contains a varying number of accessory intermediate chains. The complex is involved in intracellular transport and motility. DYNLL1 is a light chain and exists as part of this complex but also physically interacts with and inhibits the activity of neuronal nitric oxide synthase. Binding of this protein destabilizes the neuronal nitric oxide synthase dimer, a conformation necessary for activity, and it may regulate numerous biologic processes through its effects on nitric oxide synthase activity.Cytoplasmic dyneins are large enzyme complexes with a molecular mass of about 1,200 kD. They contain two force-producing heads formed primarily from dynein heavy chains, and stalks linking the heads to a basal domain, which contains a varying number of accessory intermediate chains. The complex is involved in intracellular transport and motility. The protein described in this record is a light chain and exists as part of this complex but also physically interacts with and inhibits the activity of neuronal nitric oxide synthase. Binding of this protein destabilizes the neuronal nitric oxide synthase dimer, a conformation necessary for activity, and it may regulate numerous biologic processes through its effects on nitric oxide synthase activity. Alternate transcriptional splice variants have been characterized.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
10kDa
NCBI Official Full Name
dynein light chain 1, cytoplasmic
NCBI Official Synonym Full Names
dynein light chain LC8-type 1
NCBI Official Symbol
DYNLL1
NCBI Official Synonym Symbols
LC8; PIN; DLC1; DLC8; LC8a; DNCL1; hdlc1; DNCLC1
NCBI Protein Information
dynein light chain 1, cytoplasmic
UniProt Protein Name
Dynein light chain 1, cytoplasmic
UniProt Gene Name
DYNLL1
UniProt Synonym Gene Names
DLC1; DNCL1; DNCLC1; HDLC1; DLC8; PIN
UniProt Entry Name
DYL1_HUMAN

NCBI Description

Cytoplasmic dyneins are large enzyme complexes with a molecular mass of about 1,200 kD. They contain two force-producing heads formed primarily from dynein heavy chains, and stalks linking the heads to a basal domain, which contains a varying number of accessory intermediate chains. The complex is involved in intracellular transport and motility. The protein described in this record is a light chain and exists as part of this complex but also physically interacts with and inhibits the activity of neuronal nitric oxide synthase. Binding of this protein destabilizes the neuronal nitric oxide synthase dimer, a conformation necessary for activity, and it may regulate numerous biologic processes through its effects on nitric oxide synthase activity. Alternate transcriptional splice variants have been characterized. [provided by RefSeq, Jul 2008]

Uniprot Description

LC8: a highly conserved cytoplasmic protein of the dynein light chain family. Cytoplasmic dyneins are large enzyme complexes. They contain two force-producing heads formed primarily from dynein heavy chains, and stalks linking the heads to a basal domain. Interacts with and inhibits the activity of neuronal nitric oxide synthase (nNOS). A highly conserved protein, showing 92% amino acid similarity with the nematode homolog. Binding of this protein destabilizes the nNOS dimer, a conformation necessary for activity, and it may regulate numerous biologic processes through its effects on nitric oxide synthase activity.

Protein type: Motility/polarity/chemotaxis; Motor; Microtubule-binding

Chromosomal Location of Human Ortholog: 12q24.23

Cellular Component: signalosome; kinetochore; microtubule; centrosome; cytoplasmic dynein complex; mitochondrion; membrane; cytoplasm; plasma membrane; cytosol; nucleus

Molecular Function: protein C-terminus binding; protein domain specific binding; protein binding; protein homodimerization activity; enzyme binding; nitric-oxide synthase regulator activity; motor activity

Biological Process: anatomical structure morphogenesis; viral reproduction; transcription, DNA-dependent; apoptosis; organelle organization and biogenesis; female gamete generation; antigen processing and presentation of exogenous peptide antigen via MHC class II; microtubule-based process; substantia nigra development; regulation of transcription, DNA-dependent; regulation of catalytic activity; transport; negative regulation of phosphorylation; mitotic cell cycle; G2/M transition of mitotic cell cycle; actin cytoskeleton organization and biogenesis

Research Articles on DYNLL1

Similar Products

Product Notes

The DYNLL1 dynll1 (Catalog #AAA3210277) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DYNLL1 antibody - middle region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's DYNLL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DYNLL1 dynll1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EKDIAAHIKK EFDKKYNPTW HCIVGRNFGS YVTHETKHFI YFYLGQVAIL. It is sometimes possible for the material contained within the vial of "DYNLL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.