Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human STK25 Monoclonal Antibody | anti-STK25 antibody

STK25 (Serine/threonine-protein Kinase 25, Ste20-like Kinase, Sterile 20/oxidant Stress-response Kinase 1, SOK-1, Ste20/oxidant Stress Response Kinase 1, SOK1, YSK1)

Gene Names
STK25; SOK1; YSK1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
STK25; Monoclonal Antibody; STK25 (Serine/threonine-protein Kinase 25; Ste20-like Kinase; Sterile 20/oxidant Stress-response Kinase 1; SOK-1; Ste20/oxidant Stress Response Kinase 1; SOK1; YSK1); Anti -STK25 (Serine/threonine-protein Kinase 25; anti-STK25 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1G6
Specificity
Recognizes human STK25.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
FPPTIRPSPHSKLHKGTALHSSQKPAEPVKRQPRSQCLSTLVRPVFGELKEKHKQSGGSVGALEELENAFSLAEESCPGISDKLMVHLVERVQRFSHNRNHLTSTR
Applicable Applications for anti-STK25 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa321-426 from STK25 (AAH07852) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Product Categories/Family for anti-STK25 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48,112 Da
NCBI Official Full Name
serine/threonine-protein kinase 25 isoform 1
NCBI Official Synonym Full Names
serine/threonine kinase 25
NCBI Official Symbol
STK25
NCBI Official Synonym Symbols
SOK1; YSK1
NCBI Protein Information
serine/threonine-protein kinase 25; ste20-like kinase; Ste20, yeast homolog; ste20/oxidant stress response kinase 1; sterile 20/oxidant stress-response kinase 1
UniProt Protein Name
Serine/threonine-protein kinase 25
UniProt Gene Name
STK25
UniProt Synonym Gene Names
SOK1; YSK1; SOK-1
UniProt Entry Name
STK25_HUMAN

NCBI Description

This gene encodes a member of the germinal centre kinase III (GCK III) subfamily of the sterile 20 superfamily of kinases. The encoded enzyme plays a role in serine-threonine liver kinase B1 (LKB1) signaling pathway to regulate neuronal polarization and morphology of the Golgi apparatus. The protein is translocated from the Golgi apparatus to the nucleus in response to chemical anoxia and plays a role in regulation of cell death. A pseudogene associated with this gene is located on chromosome 18. Multiple alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Dec 2012]

Uniprot Description

YSK1: Oxidant stress-activated serine/threonine kinase that may play a role in the response to environmental stress. Targets to the Golgi apparatus where it appears to regulate protein transport events, cell adhesion, and polarity complexes important for cell migration. Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily.

Protein type: Kinase, protein; Protein kinase, STE; EC 2.7.11.1; Protein kinase, Ser/Thr (non-receptor); STE group; STE20 family; YSK subfamily

Chromosomal Location of Human Ortholog: 2q37.3

Cellular Component: Golgi apparatus; cytoplasm

Molecular Function: protein binding; protein homodimerization activity; metal ion binding; ATP binding; receptor signaling protein serine/threonine kinase activity; protein kinase activity

Biological Process: Golgi localization; response to hydrogen peroxide; apoptosis; establishment of Golgi localization; regulation of cell differentiation; protein amino acid autophosphorylation; establishment and/or maintenance of cell polarity; positive regulation of axonogenesis; response to oxidative stress; signal transduction; protein amino acid phosphorylation; positive regulation of stress-activated MAPK cascade

Research Articles on STK25

Similar Products

Product Notes

The STK25 stk25 (Catalog #AAA642239) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The STK25 (Serine/threonine-protein Kinase 25, Ste20-like Kinase, Sterile 20/oxidant Stress-response Kinase 1, SOK-1, Ste20/oxidant Stress Response Kinase 1, SOK1, YSK1) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's STK25 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the STK25 stk25 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: FPPTIRPSPH SKLHKGTALH SSQKPAEPVK RQPRSQCLST LVRPVFGELK EKHKQSGGSV GALEELENAF SLAEESCPGI SDKLMVHLVE RVQRFSHNRN HLTSTR. It is sometimes possible for the material contained within the vial of "STK25, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.