Mouse anti-Human PCAF Monoclonal Antibody | anti-PCAF antibody

PCAF (KAT2B, PCAF, Histone Acetyltransferase KAT2B, Histone Acetyltransferase PCAF, Lysine Acetyltransferase 2B, P300/CBP-associated Factor, GCN5, GCN5L) (FITC)

Cat. Num. AAA6148695

• Gene Names: KAT2B; CAF; PCAF; P/CAF
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: PCAF; Monoclonal Antibody; PCAF (KAT2B; Histone Acetyltransferase KAT2B; Histone Acetyltransferase PCAF; Lysine Acetyltransferase 2B; P300/CBP-associated Factor; GCN5; GCN5L) (FITC); anti-PCAF antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1H2
• Specificity: Recognizes human PCAF.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
• Sequence Length: 4443

• Applicable Applications for anti-PCAF antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa353-452 from PCAF (AAH60823) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: LEEEVYSQNSPIWDQDFLSASSRTSQLGIQTVINPPPVAGTISYNSTSSSLEQPNAGSSSPACKASSGLEANPGEKRKMTDSHVLEEAKKPRVMGDIPME
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(PCAF monoclonal antibody. Western Blot analysis of PCAF expression in human uterus myoma.)

Western Blot (WB)

(PCAF monoclonal antibody. Western Blot analysis of PCAF expression in LNCaP.)

Western Blot (WB)

(PCAF monoclonal antibody Western Blot analysis of PCAF expression in Hela NE.)

Western Blot (WB)

(Western Blot analysis of PCAF expression in transfected 293T cell line by PCAF monoclonal antibody. Lane 1: PCAF transfected lysate (93kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-PCAF antibody

Functions as a histone acetyltransferase (HAT) to promote transcriptional activation. Has significant histone acetyltransferase activity with core histones (H3 and H4), and also with nucleosome core particles. Inhibits cell-cycle progression and counteracts the mitogenic activity of the adenoviral oncoprotein E1A. In case of HIV-1 infection, it is recruited by the viral protein Tat. Regulates Tat's transactivating activity and may help inducing chromatin remodeling of proviral genes.

Product Categories/Family for anti-PCAF antibody

Antibodies; Enzymes; Acetyltransferase

NCBI and Uniprot Product Information

• NCBI GI #: 38173797
• NCBI GeneID: 8850
• NCBI Official Full Name: Homo sapiens K(lysine) acetyltransferase 2B, mRNA
• NCBI Official Synonym Full Names: lysine acetyltransferase 2B
• NCBI Official Symbol: KAT2B
• NCBI Official Synonym Symbols: CAF; PCAF; P/CAF
• NCBI Protein Information: histone acetyltransferase KAT2B

NCBI Description

CBP and p300 are large nuclear proteins that bind to many sequence-specific factors involved in cell growth and/or differentiation, including c-jun and the adenoviral oncoprotein E1A. The protein encoded by this gene associates with p300/CBP. It has in vitro and in vivo binding activity with CBP and p300, and competes with E1A for binding sites in p300/CBP. It has histone acetyl transferase activity with core histones and nucleosome core particles, indicating that this protein plays a direct role in transcriptional regulation. [provided by RefSeq, Jul 2008]