Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: DPEP1Sample Tissue: Human DLD1 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human DPEP1 Polyclonal Antibody | anti-DPEP1 antibody

DPEP1 Antibody - middle region

Gene Names
DPEP1; MDP; RDP; MBD1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
DPEP1; Polyclonal Antibody; DPEP1 Antibody - middle region; anti-DPEP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TGDSEPQSQGLSPFGQRVVKELNRLGVLIDLAHVSVATMKATLQLSRAPV
Sequence Length
411
Applicable Applications for anti-DPEP1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human DPEP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: DPEP1Sample Tissue: Human DLD1 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: DPEP1Sample Tissue: Human DLD1 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-DPEP1 antibody
The protein encoded by this gene is a kidney membrane enzyme involved in the metabolism of glutathione and other similar proteins by dipeptide hydrolysis. The encoded protein is known to regulate leukotriene activity by catalyzing the conversion of leukotriene D4 to leukotriene E4. This protein uses zinc as a cofactor and acts as a disulfide-linked homodimer. Two transcript variants encoding the same protein have been found for this gene.
Product Categories/Family for anti-DPEP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45 kDa
NCBI Official Full Name
dipeptidase 1
NCBI Official Synonym Full Names
dipeptidase 1
NCBI Official Symbol
DPEP1
NCBI Official Synonym Symbols
MDP; RDP; MBD1
NCBI Protein Information
dipeptidase 1
UniProt Protein Name
Dipeptidase 1
Protein Family
UniProt Gene Name
DPEP1
UniProt Synonym Gene Names
MDP; RDP; hRDP
UniProt Entry Name
DPEP1_HUMAN

NCBI Description

The protein encoded by this gene is a kidney membrane enzyme involved in the metabolism of glutathione and other similar proteins by dipeptide hydrolysis. The encoded protein is known to regulate leukotriene activity by catalyzing the conversion of leukotriene D4 to leukotriene E4. This protein uses zinc as a cofactor and acts as a disulfide-linked homodimer. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jan 2012]

Uniprot Description

DPEP1: Hydrolyzes a wide range of dipeptides. Implicated in the renal metabolism of glutathione and its conjugates. Converts leukotriene D4 to leukotriene E4; it may play an important role in the regulation of leukotriene activity. Belongs to the peptidase M19 family.

Protein type: Protease; EC 3.4.13.19; Membrane protein, GPI anchor

Chromosomal Location of Human Ortholog: 16q24.3

Cellular Component: extracellular space; microvillus membrane; apical part of cell; apical plasma membrane; plasma membrane; cell junction; nucleus

Molecular Function: protein binding; metalloexopeptidase activity; zinc ion binding; dipeptidyl-peptidase activity; caspase inhibitor activity

Biological Process: glutathione metabolic process; xenobiotic metabolic process; arachidonic acid metabolic process; leukotriene metabolic process; homocysteine metabolic process; negative regulation of caspase activity; proteolysis; negative regulation of cell migration; antibiotic metabolic process; negative regulation of apoptosis

Research Articles on DPEP1

Similar Products

Product Notes

The DPEP1 dpep1 (Catalog #AAA3221969) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DPEP1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DPEP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DPEP1 dpep1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TGDSEPQSQG LSPFGQRVVK ELNRLGVLID LAHVSVATMK ATLQLSRAPV. It is sometimes possible for the material contained within the vial of "DPEP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.