Rabbit anti-Human Diazepam Binding Inhibitor Polyclonal Antibody | anti-DBI antibody

Diazepam Binding Inhibitor (DBI, Acyl-CoA-binding Protein, ACBP, Endozepine, EP) (HRP)

Cat. Num. AAA6376209

• Gene Names: DBI; EP; ACBP; ACBD1; CCK-RP
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: Diazepam Binding Inhibitor; Polyclonal Antibody; Diazepam Binding Inhibitor (DBI; Acyl-CoA-binding Protein; ACBP; Endozepine; EP) (HRP); anti-DBI antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human DBI.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).

• Applicable Applications for anti-DBI antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human DBI, aa1-104 (NP_065438.1).
• Immunogen Sequence: MWGDLWLLPPASANPGTGTEAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI
• Conjugate: HRP
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of DBI expression in transfected 293T cell line by DBI polyclonal antibody. Lane 1: DBI transfected lysate (11.8kD). Lane 2: Non-transfected lysate)

Related Product Information for anti-DBI antibody

Diazepam Binding Inhibitor (DBI) is a highly conserved 10kD polypeptide which is expressed in various species range from yeast to mammals. As an inverse agonist for benzodiazepine receptors, DBI downregulates inhibitory effects of GABA. It also has potential to induce anxiety. Found in central andperipheral tissues, DBI also participates in metabolism of steroids, which has been known to partially modify GABAA receptor function in the CNS. In peripheral tissues, DBI plays regulatory roles in steroidogenesis. DBI levels have been reported to be decreased in the cerebrospinal fluid obtained from patients with Alzheimer disease.

Product Categories/Family for anti-DBI antibody

Antibodies; Neuroscience

NCBI and Uniprot Product Information

• NCBI GI #: 10140853
• NCBI GeneID: 1622
• NCBI Accession #: NP_065438.1
• NCBI GenBank Nucleotide #: NM_020548
• UniProt Accession #: P07108; P08869; Q4VWZ6; Q53SQ7; Q6IB48; Q9UCI8; B8ZWD2; B8ZWD6; B8ZWD7
• Molecular Weight: 13,911 Da
• NCBI Official Full Name: acyl-CoA-binding protein isoform 1
• NCBI Official Synonym Full Names: diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein)
• NCBI Official Symbol: DBI
• NCBI Official Synonym Symbols: EP; ACBP; ACBD1; CCK-RP
• NCBI Protein Information: acyl-CoA-binding protein; endozepine; GABA receptor modulator; diazepam-binding inhibitor; acyl coenzyme A binding protein; acyl-Coenzyme A binding domain containing 1; cholecystokinin-releasing peptide, trypsin-sensitive; diazepam binding inhibitor (GABA
• UniProt Protein Name: Acyl-CoA-binding protein
• Protein Family: Acyl-CoA-binding protein
• UniProt Gene Name: DBI
• UniProt Synonym Gene Names: ACBP; DBI; EP
• UniProt Entry Name: ACBP_HUMAN

NCBI Description

This gene encodes diazepam binding inhibitor, a protein that is regulated by hormones and is involved in lipid metabolism and the displacement of beta-carbolines and benzodiazepines, which modulate signal transduction at type A gamma-aminobutyric acid receptors located in brain synapses. The protein is conserved from yeast to mammals, with the most highly conserved domain consisting of seven contiguous residues that constitute the hydrophobic binding site for medium- and long-chain acyl-Coenzyme A esters. Diazepam binding inhibitor is also known to mediate the feedback regulation of pancreatic secretion and the postprandial release of cholecystokinin, in addition to its role as a mediator in corticotropin-dependent adrenal steroidogenesis. Three pseudogenes located on chromosomes 6, 8 and 16 have been identified. Multiple transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

DBI: Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. It is also able to displace diazepam from the benzodiazepine (BZD) recognition site located on the GABA type A receptor. It is therefore possible that this protein also acts as a neuropeptide to modulate the action of the GABA receptor. Belongs to the ACBP family. 6 isoforms of the human protein are produced by alternative promoter.

Protein type: Lipid-binding

Chromosomal Location of Human Ortholog: 2q12-q21

Cellular Component: Golgi apparatus; mitochondrion; endoplasmic reticulum

Molecular Function: protein dimerization activity; benzodiazepine receptor binding; lipid binding

Biological Process: learning and/or memory; protein palmitoylation; triacylglycerol metabolic process; behavioral fear response; hair follicle development; transport; lateral ventricle development