Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of DBI expression in transfected 293T cell line by DBI polyclonal antibody. Lane 1: DBI transfected lysate (11.8kD). Lane 2: Non-transfected lysate)

Rabbit anti-Human Diazepam Binding Inhibitor Polyclonal Antibody | anti-DBI antibody

Diazepam Binding Inhibitor (DBI, Acyl-CoA-binding Protein, ACBP, Endozepine, EP) (PE)

Gene Names
DBI; EP; ACBP; ACBD1; CCK-RP
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Diazepam Binding Inhibitor; Polyclonal Antibody; Diazepam Binding Inhibitor (DBI; Acyl-CoA-binding Protein; ACBP; Endozepine; EP) (PE); anti-DBI antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human DBI.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-DBI antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human DBI, aa1-104 (NP_065438.1).
Immunogen Sequence
MWGDLWLLPPASANPGTGTEAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI
Conjugate
PE
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of DBI expression in transfected 293T cell line by DBI polyclonal antibody. Lane 1: DBI transfected lysate (11.8kD). Lane 2: Non-transfected lysate)

Western Blot (WB) (Western Blot analysis of DBI expression in transfected 293T cell line by DBI polyclonal antibody. Lane 1: DBI transfected lysate (11.8kD). Lane 2: Non-transfected lysate)
Related Product Information for anti-DBI antibody
Diazepam Binding Inhibitor (DBI) is a highly conserved 10kD polypeptide which is expressed in various species range from yeast to mammals. As an inverse agonist for benzodiazepine receptors, DBI downregulates inhibitory effects of GABA. It also has potential to induce anxiety. Found in central andperipheral tissues, DBI also participates in metabolism of steroids, which has been known to partially modify GABAA receptor function in the CNS. In peripheral tissues, DBI plays regulatory roles in steroidogenesis. DBI levels have been reported to be decreased in the cerebrospinal fluid obtained from patients with Alzheimer disease.
Product Categories/Family for anti-DBI antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
13,911 Da
NCBI Official Full Name
acyl-CoA-binding protein isoform 1
NCBI Official Synonym Full Names
diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein)
NCBI Official Symbol
DBI
NCBI Official Synonym Symbols
EP; ACBP; ACBD1; CCK-RP
NCBI Protein Information
acyl-CoA-binding protein; endozepine; GABA receptor modulator; diazepam-binding inhibitor; acyl coenzyme A binding protein; acyl-Coenzyme A binding domain containing 1; cholecystokinin-releasing peptide, trypsin-sensitive; diazepam binding inhibitor (GABA
UniProt Protein Name
Acyl-CoA-binding protein
Protein Family
UniProt Gene Name
DBI
UniProt Synonym Gene Names
ACBP; DBI; EP
UniProt Entry Name
ACBP_HUMAN

NCBI Description

This gene encodes diazepam binding inhibitor, a protein that is regulated by hormones and is involved in lipid metabolism and the displacement of beta-carbolines and benzodiazepines, which modulate signal transduction at type A gamma-aminobutyric acid receptors located in brain synapses. The protein is conserved from yeast to mammals, with the most highly conserved domain consisting of seven contiguous residues that constitute the hydrophobic binding site for medium- and long-chain acyl-Coenzyme A esters. Diazepam binding inhibitor is also known to mediate the feedback regulation of pancreatic secretion and the postprandial release of cholecystokinin, in addition to its role as a mediator in corticotropin-dependent adrenal steroidogenesis. Three pseudogenes located on chromosomes 6, 8 and 16 have been identified. Multiple transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

DBI: Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. It is also able to displace diazepam from the benzodiazepine (BZD) recognition site located on the GABA type A receptor. It is therefore possible that this protein also acts as a neuropeptide to modulate the action of the GABA receptor. Belongs to the ACBP family. 6 isoforms of the human protein are produced by alternative promoter.

Protein type: Lipid-binding

Chromosomal Location of Human Ortholog: 2q12-q21

Cellular Component: Golgi apparatus; mitochondrion; endoplasmic reticulum

Molecular Function: protein dimerization activity; benzodiazepine receptor binding; lipid binding

Biological Process: learning and/or memory; protein palmitoylation; triacylglycerol metabolic process; behavioral fear response; hair follicle development; transport; lateral ventricle development

Research Articles on DBI

Similar Products

Product Notes

The DBI dbi (Catalog #AAA6376215) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Diazepam Binding Inhibitor (DBI, Acyl-CoA-binding Protein, ACBP, Endozepine, EP) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Diazepam Binding Inhibitor can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DBI dbi for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Diazepam Binding Inhibitor, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.