Mouse HGD Monoclonal Antibody | anti-HGD antibody

HGD (Homogentisate 1,2-dioxygenase (Homogentisate Oxidase), AKU, HGO) (FITC)

Cat. Num. AAA6177140

• Gene Names: HGD; AKU; HGO
• Applications: Immunofluorescence, Immunoprecipitation
• Purity: Purified
• Synonyms: HGD; Monoclonal Antibody; HGD (Homogentisate 1; 2-dioxygenase (Homogentisate Oxidase); AKU; HGO) (FITC); Homogentisate 1; HGO; anti-HGD antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 2C10
• Specificity: Recognizes HGD.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-HGD antibody: Immunofluorescence (IF), Immunoprecipitation (IP)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: HGD (NP_000178, 377aa-445aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: CFEKASKVKLAPERIADGTMAFMFESSLSLAVTKWGLKASRCLDENYHKCWEPLKSHFTPNSRNPAEPN
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.; ; FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged HGD is 1 ng/ml as a capture antibody.)

Immunoprecipitation (IP)

(Immunoprecipitation of HGD transfected lysate using anti-HGD monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with HGD MaxPab rabbit polyclonal antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to HGD on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to HGD on HeLa cell. [antibody concentration 10 ug/ml])

Related Product Information for anti-HGD antibody

Homogentisate 1,2-dioxygenase (HGD) gene mutations are the molecular cause of alkaptonuria, a rare hereditary disorder of the phenylalanine catabolism. The highest expression of HGD is in the prostate, small intestine, colon, and liver. The HGD gene contains 14 exons. Conflicting reports have placed the gene at 3q2, 3q13.3-q21, 3q21-q24, 3q21-q23, or 3q25-q26. [provided by RefSeq]

Product Categories/Family for anti-HGD antibody

Antibodies; Enzymes; Oxidase

NCBI and Uniprot Product Information

• NCBI GI #: 115527117
• NCBI GeneID: 3081
• NCBI Accession #: NP_000178
• NCBI GenBank Nucleotide #: NM_000187
• UniProt Accession #: Q93099
• Molecular Weight: 50kDa
• NCBI Official Full Name: homogentisate 1,2-dioxygenase
• NCBI Official Synonym Full Names: homogentisate 1,2-dioxygenase
• NCBI Official Symbol: HGD
• NCBI Official Synonym Symbols: AKU; HGO
• NCBI Protein Information: homogentisate 1,2-dioxygenase
• UniProt Protein Name: Homogentisate 1,2-dioxygenase
• Protein Family: 2-(hydroxymethyl)glutarate dehydrogenase
• UniProt Gene Name: HGD
• UniProt Synonym Gene Names: HGO
• UniProt Entry Name: HGD_HUMAN

NCBI Description

This gene encodes the enzyme homogentisate 1,2 dioxygenase. This enzyme is involved in the catabolism of the amino acids tyrosine and phenylalanine. Mutations in this gene are the cause of the autosomal recessive metabolism disorder alkaptonuria.[provided by RefSeq, May 2010]