Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-DGKQ Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: ACHN cell lysate)

Rabbit DGKQ Polyclonal Antibody | anti-DGKQ antibody

DGKQ antibody - middle region

Gene Names
DGKQ; DAGK; DAGK4; DAGK7
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DGKQ; Polyclonal Antibody; DGKQ antibody - middle region; anti-DGKQ antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DAELSLDFHQAREEEPGKFTSRLHNKGVYVRVGLQKISHSRSLHKQIRLQ
Sequence Length
942
Applicable Applications for anti-DGKQ antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 86%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human DGKQ
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-DGKQ Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: ACHN cell lysate)

Western Blot (WB) (WB Suggested Anti-DGKQ Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: ACHN cell lysate)
Related Product Information for anti-DGKQ antibody
This is a rabbit polyclonal antibody against DGKQ. It was validated on Western Blot

Target Description: The protein encoded by this gene contains three cysteine-rich domains, a proline-rich region, and a pleckstrin homology domain with an overlapping Ras-associating domain. It is localized in the speckle domains of the nucleus, and mediates the regeneration of phosphatidylinositol (PI) from diacylglycerol in the PI-cycle during cell signal transduction.
Product Categories/Family for anti-DGKQ antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
101kDa
NCBI Official Full Name
diacylglycerol kinase theta
NCBI Official Synonym Full Names
diacylglycerol kinase theta
NCBI Official Symbol
DGKQ
NCBI Official Synonym Symbols
DAGK; DAGK4; DAGK7
NCBI Protein Information
diacylglycerol kinase theta
UniProt Protein Name
Diacylglycerol kinase theta
Protein Family
UniProt Gene Name
DGKQ
UniProt Synonym Gene Names
DAGK4; DAG kinase theta; DGK-theta
UniProt Entry Name
DGKQ_HUMAN

NCBI Description

The protein encoded by this gene contains three cysteine-rich domains, a proline-rich region, and a pleckstrin homology domain with an overlapping Ras-associating domain. It is localized in the speckle domains of the nucleus, and mediates the regeneration of phosphatidylinositol (PI) from diacylglycerol in the PI-cycle during cell signal transduction. [provided by RefSeq, Jul 2008]

Uniprot Description

DGKQ: Phosphorylates diacylglycerol (DAG) to generate phosphatidic acid (PA). May regulate the activity of protein kinase C by controlling the balance between these two signaling lipids. Activated in the nucleus in response to alpha-thrombin and nerve growth factor. May be involved in cAMP- induced activation of NR5A1 and subsequent steroidogenic gene transcription by delivering PA as ligand for NR5A1. Acts synergistically with NR5A1 on CYP17 transcriptional activity. Belongs to the eukaryotic diacylglycerol kinase family.

Protein type: Kinase, lipid; Motility/polarity/chemotaxis; Lipid Metabolism - glycerolipid; Lipid Metabolism - glycerophospholipid; EC 2.7.1.107

Chromosomal Location of Human Ortholog: 4p16.3

Cellular Component: cytoskeleton; cytoplasm; plasma membrane; nuclear speck; cytosol; nucleus

Molecular Function: protein binding; phospholipase binding; transcription activator binding; metal ion binding; kinase binding; diacylglycerol kinase activity; ATP binding; NAD+ kinase activity

Biological Process: regulation of transcription from RNA polymerase II promoter; platelet activation; G-protein coupled receptor protein signaling pathway; cAMP-mediated signaling; protein kinase C activation; blood coagulation; phosphorylation; response to ATP

Research Articles on DGKQ

Similar Products

Product Notes

The DGKQ dgkq (Catalog #AAA3210524) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DGKQ antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DGKQ can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DGKQ dgkq for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DAELSLDFHQ AREEEPGKFT SRLHNKGVYV RVGLQKISHS RSLHKQIRLQ. It is sometimes possible for the material contained within the vial of "DGKQ, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.