Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-DEDD2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Lung)

Rabbit DEDD2 Polyclonal Antibody | anti-DEDD2 antibody

DEDD2 antibody - middle region

Gene Names
DEDD2; FLAME3; FLAME-3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DEDD2; Polyclonal Antibody; DEDD2 antibody - middle region; anti-DEDD2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PQQQSEPARPSSEGKVTCDIRLRVRAEYCEHGPALEQGVASRRPQALARQ
Sequence Length
326
Applicable Applications for anti-DEDD2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human DEDD2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-DEDD2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Lung)

Western Blot (WB) (WB Suggested Anti-DEDD2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Lung)
Related Product Information for anti-DEDD2 antibody
This is a rabbit polyclonal antibody against DEDD2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: DEDD2 may play a critical role in death receptor-induced apoptosis and may target CASP8 and CASP10 to the nucleus. DEDD2 may regulate degradation of intermediate filaments during apoptosis. DEDD2 may play a role in the general transcription machinery in the nucleus and might be an important regulator of the activity of GTF3C3.
Product Categories/Family for anti-DEDD2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36
NCBI Official Full Name
DNA-binding death effector domain-containing protein 2 isoform 1
NCBI Official Synonym Full Names
death effector domain containing 2
NCBI Official Symbol
DEDD2
NCBI Official Synonym Symbols
FLAME3; FLAME-3
NCBI Protein Information
DNA-binding death effector domain-containing protein 2
UniProt Protein Name
DNA-binding death effector domain-containing protein 2
UniProt Gene Name
DEDD2
UniProt Synonym Gene Names
FLAME3
UniProt Entry Name
DEDD2_HUMAN

NCBI Description

This gene encodes a nuclear-localized protein containing a death effector domain (DED). The encoded protein may regulate the trafficking of caspases and other proteins into the nucleus during death receptor-induced apoptosis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2012]

Uniprot Description

DEDD2: May play a critical role in death receptor-induced apoptosis and may target CASP8 and CASP10 to the nucleus. May regulate degradation of intermediate filaments during apoptosis. May play a role in the general transcription machinery in the nucleus and might be an important regulator of the activity of GTF3C3. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Nucleolus

Chromosomal Location of Human Ortholog: 19q13.2

Cellular Component: nucleoplasm; nucleolus

Molecular Function: protein binding; receptor signaling complex scaffold activity; DNA binding

Biological Process: RNA processing; induction of apoptosis via death domain receptors; transcription, DNA-dependent; apoptotic nuclear changes; rRNA catabolic process; cellular homeostasis; negative regulation of transcription, DNA-dependent

Research Articles on DEDD2

Similar Products

Product Notes

The DEDD2 dedd2 (Catalog #AAA3210851) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DEDD2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DEDD2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DEDD2 dedd2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PQQQSEPARP SSEGKVTCDI RLRVRAEYCE HGPALEQGVA SRRPQALARQ. It is sometimes possible for the material contained within the vial of "DEDD2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.