Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: DDX60LSample Type: PANC1 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Horse, Human DDX60L Polyclonal Antibody | anti-DDX60L antibody

DDX60L Antibody - N-terminal region

Reactivity
Horse, Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DDX60L; Polyclonal Antibody; DDX60L Antibody - N-terminal region; anti-DDX60L antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Horse, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YAYTMESTDRNQTFSKENETVIQSAYKSLIQHLEEIRVLVLATHFEHLKW
Sequence Length
1706
Applicable Applications for anti-DDX60L antibody
Western Blot (WB)
Homology
Horse: 77%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human DDX60L
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: DDX60LSample Type: PANC1 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: DDX60LSample Type: PANC1 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-DDX60L antibody
This is a rabbit polyclonal antibody against DDX60L. It was validated on Western Blot

Target Description: The function of this protein remains unknown.
Product Categories/Family for anti-DDX60L antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
187kDa
NCBI Official Full Name
probable ATP-dependent RNA helicase DDX60-like isoform 1
NCBI Official Synonym Full Names
DExD/H-box 60 like
NCBI Official Symbol
DDX60L
NCBI Protein Information
probable ATP-dependent RNA helicase DDX60-like
UniProt Protein Name
Probable ATP-dependent RNA helicase DDX60-like
UniProt Gene Name
DDX60L

NCBI Description

This gene encodes a member of the DExD/H-box helicase family of proteins, a subset of the super family 2 helicases. Members of the DExD/H-box helicase family share a conserved functional core comprised of two RecA-like globular domains. These domains contain conserved motifs that mediate ATP binding, ATP hydrolysis, nucleic acid binding, and RNA unwinding. In addition to functions in RNA metabolism, members of this family are involved in anti-viral immunity and act as cytosolic sensors of viral nucleic acids. The protein encoded by this gene has been shown to inhibit hepatitis C virus replication in response to interferon stimulation in cell culture. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2016]

Uniprot Description

DDX60L: Belongs to the helicase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.6.4.13; Helicase

Chromosomal Location of Human Ortholog: 4q32.3

Molecular Function: ATP binding; helicase activity; RNA binding

Research Articles on DDX60L

Similar Products

Product Notes

The DDX60L ddx60l (Catalog #AAA3217778) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DDX60L Antibody - N-terminal region reacts with Horse, Human and may cross-react with other species as described in the data sheet. AAA Biotech's DDX60L can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DDX60L ddx60l for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YAYTMESTDR NQTFSKENET VIQSAYKSLI QHLEEIRVLV LATHFEHLKW. It is sometimes possible for the material contained within the vial of "DDX60L, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.