Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: LMOD3Sample Type: HCT15 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit LMOD3 Polyclonal Antibody | anti-LMOD3 antibody

LMOD3 Antibody - N-terminal region

Gene Names
LMOD3; NEM10
Reactivity
Cow, Dog, Horse, Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
LMOD3; Polyclonal Antibody; LMOD3 Antibody - N-terminal region; anti-LMOD3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VKSEEKTQEEHEEIEKRNKNMAQYLKEKLNNEIVANKRESKGSSNIQETD
Sequence Length
348
Applicable Applications for anti-LMOD3 antibody
Western Blot (WB)
Homology
Cow: 77%; Dog: 77%; Horse: 79%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human LMOD3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: LMOD3Sample Type: HCT15 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: LMOD3Sample Type: HCT15 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-LMOD3 antibody
This is a rabbit polyclonal antibody against LMOD3. It was validated on Western Blot

Target Description: The function of this protein remains unknown.
Product Categories/Family for anti-LMOD3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
LMOD3 protein
NCBI Official Synonym Full Names
leiomodin 3
NCBI Official Symbol
LMOD3
NCBI Official Synonym Symbols
NEM10
NCBI Protein Information
leiomodin-3
UniProt Protein Name
Leiomodin-3
Protein Family
UniProt Gene Name
LMOD3

NCBI Description

The protein encoded by this gene is a member of the leiomodin family of proteins. This protein contains three actin-binding domains, a tropomyosin domain, a leucine-rich repeat domain, and a Wiskott-Aldrich syndrome protein homology 2 domain (WH2). Localization of this protein to the pointed ends of thin filaments has been observed, and there is evidence that this protein acts as a catalyst of actin nucleation, and is important to the organization of sarcomeric thin filaments in skeletal muscles. Mutations in this gene have been associated as one cause of Nemaline myopathy, as other genes have also been linked to this disorder. Nemaline myopathy is a disorder characterized by nonprogressive generalized muscle weakness and protein inclusions (nemaline bodies) in skeletal myofibers. Patients with mutations in this gene often present with a severe congenital form of the disorder. [provided by RefSeq, Jan 2015]

Uniprot Description

Essential for the organization of sarcomeric actin thin filaments in skeletal muscle (PubMed:25250574). Increases the rate of actin polymerization (PubMed:25250574).

Research Articles on LMOD3

Similar Products

Product Notes

The LMOD3 lmod3 (Catalog #AAA3218610) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LMOD3 Antibody - N-terminal region reacts with Cow, Dog, Horse, Human and may cross-react with other species as described in the data sheet. AAA Biotech's LMOD3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LMOD3 lmod3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VKSEEKTQEE HEEIEKRNKN MAQYLKEKLN NEIVANKRES KGSSNIQETD. It is sometimes possible for the material contained within the vial of "LMOD3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.