Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CE030Sample Type: Mouse PancreasAntibody Dilution: 1.0ug/ml)

Rabbit anti-Mouse D1Ertd622e Polyclonal Antibody | anti-D1ERTD622E antibody

D1Ertd622e Antibody - N-terminal

Gene Names
D1Ertd622e; AI987691; AW047450
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
D1Ertd622e; Polyclonal Antibody; D1Ertd622e Antibody - N-terminal; anti-D1ERTD622E antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TLPLPVAEGSSPGKAEAEKPRCSSTPCSPMRRTVSGYQILHMDSNYLVGF
Sequence Length
207
Applicable Applications for anti-D1ERTD622E antibody
Western Blot (WB)
Immunogen
The immunogen for Anti-D1Ertd622e antibody is: synthetic peptide directed towards the N-terminal of Mouse CE030
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CE030Sample Type: Mouse PancreasAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CE030Sample Type: Mouse PancreasAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-D1ERTD622E antibody
This is a rabbit polyclonal antibody against CE030. It was validated on Western Blot
Product Categories/Family for anti-D1ERTD622E antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22 kDa
NCBI Official Synonym Full Names
DNA segment, Chr 1, ERATO Doi 622, expressed
NCBI Official Symbol
D1Ertd622e
NCBI Official Synonym Symbols
AI987691; AW047450
NCBI Protein Information
UNC119-binding protein C5orf30 homolog
UniProt Protein Name
UNC119-binding protein C5orf30 homolog
UniProt Gene Name
D1Ertd622e

Uniprot Description

Probably plays a role in trafficking of proteins via its interaction with UNC119 and UNC119B cargo adapters: may help the release of UNC119 and UNC119B cargo or the recycling of UNC119 and UNC119B. May play a role in ciliary membrane localization via its interaction with UNC119B and protein transport into photoreceptor cells ().

Research Articles on D1ERTD622E

Similar Products

Product Notes

The D1ERTD622E d1ertd622e (Catalog #AAA3218070) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The D1Ertd622e Antibody - N-terminal reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's D1Ertd622e can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the D1ERTD622E d1ertd622e for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TLPLPVAEGS SPGKAEAEKP RCSSTPCSPM RRTVSGYQIL HMDSNYLVGF. It is sometimes possible for the material contained within the vial of "D1Ertd622e, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.