Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: PI5PASample Type: COLO205 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human INPP5J Polyclonal Antibody | anti-INPP5J antibody

INPP5J Antibody - C-terminal region

Gene Names
INPP5J; PIPP; INPP5; PIB5PA
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
INPP5J; Polyclonal Antibody; INPP5J Antibody - C-terminal region; anti-INPP5J antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SSRERRGASRSPSPQSRRLSRVAPDRSSNGSSRGSSEEGPSGLPGPWAFP
Sequence Length
1006
Applicable Applications for anti-INPP5J antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human PI5PA
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: PI5PASample Type: COLO205 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: PI5PASample Type: COLO205 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-INPP5J antibody
This is a rabbit polyclonal antibody against PI5PA. It was validated on Western Blot
Product Categories/Family for anti-INPP5J antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
110kDa
NCBI Official Full Name
phosphatidylinositol 4,5-bisphosphate 5-phosphatase A isoform c
NCBI Official Synonym Full Names
inositol polyphosphate-5-phosphatase J
NCBI Official Symbol
INPP5J
NCBI Official Synonym Symbols
PIPP; INPP5; PIB5PA
NCBI Protein Information
phosphatidylinositol 4,5-bisphosphate 5-phosphatase A
UniProt Protein Name
Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A
UniProt Gene Name
INPP5J
UniProt Synonym Gene Names
PIB5PA; PIPP
UniProt Entry Name
PI5PA_HUMAN

Uniprot Description

PI5PA: Inositol 5-phosphatase, which converts inositol 1,4,5- trisphosphate to inositol 1,4-bisphosphate. Also converts phosphatidylinositol 4,5-bisphosphate to phosphatidylinositol 4- phosphate and inositol 1,3,4,5-tetrakisphosphate to inositol 1,3,4-trisphosphate in vitro. May be involved in modulation of the function of inositol and phosphatidylinositol polyphosphate- binding proteins that are present at membranes ruffles. Belongs to the inositol 1,4,5-trisphosphate 5- phosphatase type II family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.1.3.56; Phosphatase (non-protein); Carbohydrate Metabolism - inositol phosphate

Chromosomal Location of Human Ortholog: 22q12.2

Cellular Component: ruffle; growth cone; cytoplasm; plasma membrane; dendritic shaft; cytosol

Molecular Function: inositol-polyphosphate 5-phosphatase activity; SH3 domain binding

Biological Process: inositol phosphate metabolic process; phospholipid metabolic process; negative regulation of microtubule polymerization; phosphatidylinositol biosynthetic process; negative regulation of peptidyl-serine phosphorylation; phosphoinositide dephosphorylation

Research Articles on INPP5J

Similar Products

Product Notes

The INPP5J inpp5j (Catalog #AAA3220046) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The INPP5J Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's INPP5J can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the INPP5J inpp5j for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SSRERRGASR SPSPQSRRLS RVAPDRSSNG SSRGSSEEGP SGLPGPWAFP. It is sometimes possible for the material contained within the vial of "INPP5J, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.