Western Blot (WB)
(Host: RabbitTarget Name: RGD1560888Sample Type: Rat Pancreas lysatesAntibody Dilution: 1.0ug/ml)
Rabbit CDK8 Polyclonal Antibody | anti-CDK8 antibody
CDK8 Antibody - N-terminal region
Gene Names
Cdk8; RGD1560888
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CDK8; Polyclonal Antibody; CDK8 Antibody - N-terminal region; anti-CDK8 antibody
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MDYDFKVKLSSERERVEDLFEYEGCKVGRGTYGHVYKAKRKDGKDDKDYA
Sequence Length
464
Applicable Applications for anti-CDK8 antibody
Western Blot (WB)
Homology
Dog: 100%; Guinea Pig: 75%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Rat RGD1560888
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: RGD1560888Sample Type: Rat Pancreas lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: RGD1560888Sample Type: Rat Pancreas lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-CDK8 antibody
This is a rabbit polyclonal antibody against RGD1560888. It was validated on Western Blot
Product Categories/Family for anti-CDK8 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
51kDa
NCBI Official Full Name
cyclin-dependent kinase 8
NCBI Official Synonym Full Names
cyclin-dependent kinase 8
NCBI Official Symbol
Cdk8
NCBI Official Synonym Symbols
RGD1560888
NCBI Protein Information
cyclin-dependent kinase 8
Protein Family
Similar Products
Product Notes
The CDK8 (Catalog #AAA3200180) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CDK8 Antibody - N-terminal region reacts with Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CDK8 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CDK8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MDYDFKVKLS SERERVEDLF EYEGCKVGRG TYGHVYKAKR KDGKDDKDYA. It is sometimes possible for the material contained within the vial of "CDK8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
