Rabbit anti-Human Cytohesin 1 Polyclonal Antibody | anti-CYTH1 antibody

Cytohesin 1 (Cytohesin-1, CYTH1, D17S811E, PH, SEC7 and Coiled-coil Domain-containing Protein 1, PSCD1, SEC7 Homolog B2-1) (HRP)

Cat. Num. AAA6391070

• Gene Names: CYTH1; B2-1; SEC7; PSCD1; D17S811E; CYTOHESIN-1
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: Cytohesin 1; Polyclonal Antibody; Cytohesin 1 (Cytohesin-1; CYTH1; D17S811E; PH; SEC7 and Coiled-coil Domain-containing Protein 1; PSCD1; SEC7 Homolog B2-1) (HRP); anti-CYTH1 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human PSCD1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).
• Sequence Length: 3311

• Applicable Applications for anti-CYTH1 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human PSCD1, aa1-398 (NP_004753.1)
• Immunogen Sequence: MEEDDSYVPSDLTAEERQELENIRRRKQELLADIQRLKDEIAEVANEIENLGSTEERKNMQRNKQVAMGRKKFNMDPKKGIQFLIENDLLKNTCEDIAQFLYKGEGLNKTAIGDYLGERDEFNIQVLHAFVELHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCQCNNGVFQSTDTCYVLSFAIIMLNTSLHNPNVKDKPTVERFIAMNRGINDGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDSKKPNCFELYIPDNKDQVIKACKTEADGRVVEGNHTVYRISAPTPEEKEEWIKCIKAAISRDPFYEMLAARKKKVSSTKRH
• Conjugate: HRP
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CYTH1 expression in transfected 293T cell line by CYTH1 polyclonal antibody. Lane 1: PSCD1 transfected lysate (46.4kD). Lane 2: Non-transfected lysate. )

Product Categories/Family for anti-CYTH1 antibody

Antibodies; Pleckstrin Homology Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 110349757
• NCBI GeneID: 9267
• NCBI Accession #: NM_004762.2
• NCBI GenBank Nucleotide #: NM_004762.2
• UniProt Accession #: Q15438
• NCBI Official Full Name: Homo sapiens cytohesin 1 (CYTH1), transcript variant 1, mRNA
• NCBI Official Synonym Full Names: cytohesin 1
• NCBI Official Symbol: CYTH1
• NCBI Official Synonym Symbols: B2-1; SEC7; PSCD1; D17S811E; CYTOHESIN-1
• NCBI Protein Information: cytohesin-1
• UniProt Protein Name: Cytohesin-1
• Protein Family: Cytohesin
• UniProt Gene Name: CYTH1
• UniProt Synonym Gene Names: D17S811E; PSCD1
• UniProt Entry Name: CYH1_HUMAN

NCBI Description

The protein encoded by this gene is a member of the PSCD family. Members of this family have identical structural organization that consists of an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain. The coiled-coil motif is involved in homodimerization, the Sec7 domain contains guanine-nucleotide exchange protein activity, and the PH domain interacts with phospholipids and is responsible for association of PSCDs with membranes. Members of this family appear to mediate the regulation of protein sorting and membrane trafficking. This gene is highly expressed in natural killer and peripheral T cells, and regulates the adhesiveness of integrins at the plasma membrane of lymphocytes. A pseudogene of this gene has been defined on the X chromosome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2014]

Uniprot Description

cytohesin 1: Promotes guanine-nucleotide exchange on ARF1 and ARF5. Promotes the activation of ARF through replacement of GDP with GTP. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: GEFs; GEFs, ARF; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 17q25

Cellular Component: cytoplasm; cytosol; extrinsic to internal side of plasma membrane; Golgi membrane; plasma membrane

Molecular Function: ARF guanyl-nucleotide exchange factor activity; protein binding

Biological Process: regulation of cell adhesion; vesicle-mediated transport