Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of CYTH1 expression in transfected 293T cell line by CYTH1 polyclonal antibody. Lane 1: PSCD1 transfected lysate (46.4kD). Lane 2: Non-transfected lysate. )

Rabbit anti-Human Cytohesin 1 Polyclonal Antibody | anti-CYTH1 antibody

Cytohesin 1 (Cytohesin-1, CYTH1, D17S811E, PH, SEC7 and Coiled-coil Domain-containing Protein 1, PSCD1, SEC7 Homolog B2-1) (AP)

Gene Names
CYTH1; B2-1; SEC7; PSCD1; D17S811E; CYTOHESIN-1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Cytohesin 1; Polyclonal Antibody; Cytohesin 1 (Cytohesin-1; CYTH1; D17S811E; PH; SEC7 and Coiled-coil Domain-containing Protein 1; PSCD1; SEC7 Homolog B2-1) (AP); anti-CYTH1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human PSCD1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
3311
Applicable Applications for anti-CYTH1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human PSCD1, aa1-398 (NP_004753.1)
Immunogen Sequence
MEEDDSYVPSDLTAEERQELENIRRRKQELLADIQRLKDEIAEVANEIENLGSTEERKNMQRNKQVAMGRKKFNMDPKKGIQFLIENDLLKNTCEDIAQFLYKGEGLNKTAIGDYLGERDEFNIQVLHAFVELHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCQCNNGVFQSTDTCYVLSFAIIMLNTSLHNPNVKDKPTVERFIAMNRGINDGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDSKKPNCFELYIPDNKDQVIKACKTEADGRVVEGNHTVYRISAPTPEEKEEWIKCIKAAISRDPFYEMLAARKKKVSSTKRH
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CYTH1 expression in transfected 293T cell line by CYTH1 polyclonal antibody. Lane 1: PSCD1 transfected lysate (46.4kD). Lane 2: Non-transfected lysate. )

Western Blot (WB) (Western Blot analysis of CYTH1 expression in transfected 293T cell line by CYTH1 polyclonal antibody. Lane 1: PSCD1 transfected lysate (46.4kD). Lane 2: Non-transfected lysate. )
Product Categories/Family for anti-CYTH1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens cytohesin 1 (CYTH1), transcript variant 1, mRNA
NCBI Official Synonym Full Names
cytohesin 1
NCBI Official Symbol
CYTH1
NCBI Official Synonym Symbols
B2-1; SEC7; PSCD1; D17S811E; CYTOHESIN-1
NCBI Protein Information
cytohesin-1
UniProt Protein Name
Cytohesin-1
Protein Family
UniProt Gene Name
CYTH1
UniProt Synonym Gene Names
D17S811E; PSCD1
UniProt Entry Name
CYH1_HUMAN

NCBI Description

The protein encoded by this gene is a member of the PSCD family. Members of this family have identical structural organization that consists of an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain. The coiled-coil motif is involved in homodimerization, the Sec7 domain contains guanine-nucleotide exchange protein activity, and the PH domain interacts with phospholipids and is responsible for association of PSCDs with membranes. Members of this family appear to mediate the regulation of protein sorting and membrane trafficking. This gene is highly expressed in natural killer and peripheral T cells, and regulates the adhesiveness of integrins at the plasma membrane of lymphocytes. A pseudogene of this gene has been defined on the X chromosome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2014]

Uniprot Description

cytohesin 1: Promotes guanine-nucleotide exchange on ARF1 and ARF5. Promotes the activation of ARF through replacement of GDP with GTP. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: GEFs; GEFs, ARF; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 17q25

Cellular Component: cytoplasm; cytosol; extrinsic to internal side of plasma membrane; Golgi membrane; plasma membrane

Molecular Function: ARF guanyl-nucleotide exchange factor activity; protein binding

Biological Process: regulation of cell adhesion; vesicle-mediated transport

Research Articles on CYTH1

Similar Products

Product Notes

The CYTH1 cyth1 (Catalog #AAA6391066) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Cytohesin 1 (Cytohesin-1, CYTH1, D17S811E, PH, SEC7 and Coiled-coil Domain-containing Protein 1, PSCD1, SEC7 Homolog B2-1) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Cytohesin 1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CYTH1 cyth1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Cytohesin 1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.