Mouse anti-Human CYTH1 Monoclonal Antibody | anti-CYTH1 antibody

CYTH1 (Cytohesin-1, PH, SEC7 and Coiled-coil Domain-containing Protein 1, SEC7 Homolog B2-1, D17S811E, PSCD1) (HRP)

Cat. Num. AAA6152061

• Gene Names: CYTH1; B2-1; SEC7; PSCD1; D17S811E; CYTOHESIN-1
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CYTH1; Monoclonal Antibody; CYTH1 (Cytohesin-1; PH; SEC7 and Coiled-coil Domain-containing Protein 1; SEC7 Homolog B2-1; D17S811E; PSCD1) (HRP); anti-CYTH1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1D6
• Specificity: Recognizes human PSCD1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 3301

• Applicable Applications for anti-CYTH1 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-398 from PSCD1 (AAH50452) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MEEDDSYVPSDLTAEERQELENIRRRKQELLADIQRLKDEIAEVANEIENLGSTEERKNMQRNKQVAMGRKKFNMDPKKGIQFLIENDLLKNTCEDIAQFLYKGEGLNKTAIGDYLGERDEFNIQVLHAFVELHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCQCNNGVFQSTDTCYVLSFAIIMLNTSLHNPNVKDKPTVERFIAMNRGINDGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDSKKPNCFELYIPDNKDQVIKACKTEADGRVVEGNHTVYRISAPTPEEKEEWIKCIKAAISRDPFYEMLAARKKKVSSTKRH
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (69.52kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to PSCD1 on formalin-fixed paraffin-embedded human spleen. [antibody concentration 3ug/ml])

Immunofluorescence (IF)

(immunofluorescence of monoclonal antibody to PSCD1 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged PSCD1 is ~1ng/ml as a capture antibody.)

Product Categories/Family for anti-CYTH1 antibody

Antibodies; Pleckstrin Homology Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 30048116
• NCBI GeneID: 9267
• NCBI Official Full Name: Homo sapiens cytohesin 1, mRNA
• NCBI Official Synonym Full Names: cytohesin 1
• NCBI Official Symbol: CYTH1
• NCBI Official Synonym Symbols: B2-1; SEC7; PSCD1; D17S811E; CYTOHESIN-1
• NCBI Protein Information: cytohesin-1
• Protein Family: Cytohesin

NCBI Description

The protein encoded by this gene is a member of the PSCD family. Members of this family have identical structural organization that consists of an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain. The coiled-coil motif is involved in homodimerization, the Sec7 domain contains guanine-nucleotide exchange protein activity, and the PH domain interacts with phospholipids and is responsible for association of PSCDs with membranes. Members of this family appear to mediate the regulation of protein sorting and membrane trafficking. This gene is highly expressed in natural killer and peripheral T cells, and regulates the adhesiveness of integrins at the plasma membrane of lymphocytes. A pseudogene of this gene has been defined on the X chromosome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2014]