Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CUL1 Antibody Titration: 1.25ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)

Rabbit CUL1 Polyclonal Antibody | anti-CUL1 antibody

CUL1 antibody - C-terminal region

Reactivity
Cow, Dog, Human, Mouse, Rat, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
CUL1; Polyclonal Antibody; CUL1 antibody - C-terminal region; anti-CUL1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Human, Mouse, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA
Sequence Length
776
Applicable Applications for anti-CUL1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human CUL1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CUL1 Antibody Titration: 1.25ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-CUL1 Antibody Titration: 1.25ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)
Related Product Information for anti-CUL1 antibody
This is a rabbit polyclonal antibody against CUL1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Cul1 may contribute to catalysis through the positioning of the substrate and the ubiquitin-conjugating enzyme
Product Categories/Family for anti-CUL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
90kDa
NCBI Official Full Name
cullin-1
NCBI Official Synonym Full Names
cullin 1
NCBI Official Symbol
CUL1
NCBI Protein Information
cullin-1
UniProt Protein Name
Cullin-1
Protein Family
UniProt Gene Name
CUL1
UniProt Synonym Gene Names
CUL-1
UniProt Entry Name
CUL1_HUMAN

Uniprot Description

CUL1: a core scaffolding component of multiple cullin-RING-based SCF (SKP1- CUL1-F-box protein) E3 ubiquitin-protein ligase complexes, which mediate the ubiquitination of proteins involved in cell cycle progression, signal transduction and transcription. The cullin subunit serves as a rigid scaffold of SCF complexes. May contribute to catalysis through positioning of the substrate and the ubiquitin-conjugating enzyme. The E3 ubiquitin-protein ligase activity of the complex depends on the neddylation of the cullin subunit. Interacts with multiple F-box proteins in SCF complexes, directing the ubiquitination of many substrates. These F-box proteins and associated substrates include: BTRC and FBXW11 bind CTNNB1 and participate in Wnt signaling; FBXW11 bind phosphorylated NFKBIA; BTRC binds NFKBIB, NFKBIE, ATF4, SMAD3, SMAD4, CDC25A, FBXO5 and probably NFKB2; SKP2 binds phosphorylated p27kip and is involved in regulation of G1/S transition; SKP2 binds ORC1, CDT1, RBL2, ELF4, CDKN1A, RAG2, FOXO1A, and probably MYC and TAL1; FBXW7 binds cyclin E, NOTCH1 released notch intracellular domain (NICD), and probably PSEN1; FBXW2 binds GCM1; FBXO32 binds MYOD1; FBXO7 binds BIRC2 and DLGAP5; FBXO33 binds YBX1; and Cyclin F binds CP110. Interacts with CHEK2, mediating its ubiquitination and regulating its function. Belongs to the cullin family.

Protein type: Ubiquitin conjugating system; Cell cycle regulation

Chromosomal Location of Human Ortholog: 7q36.1

Cellular Component: nucleoplasm; cullin-RING ubiquitin ligase complex; SCF ubiquitin ligase complex; cytosol

Molecular Function: protein binding; ubiquitin protein ligase binding

Biological Process: positive regulation of ubiquitin-protein ligase activity during mitotic cell cycle; circadian rhythm; protein monoubiquitination; SCF-dependent proteasomal ubiquitin-dependent protein catabolic process; Notch signaling pathway; viral reproduction; protein ubiquitination; negative regulation of cell proliferation; cell proliferation; organ morphogenesis; regulation of ubiquitin-protein ligase activity during mitotic cell cycle; anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process; mitotic cell cycle; cell cycle arrest; G2/M transition of mitotic cell cycle; G1/S transition of mitotic cell cycle

Research Articles on CUL1

Similar Products

Product Notes

The CUL1 cul1 (Catalog #AAA3224395) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CUL1 antibody - C-terminal region reacts with Cow, Dog, Human, Mouse, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CUL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CUL1 cul1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HQQLLGEVLT QLSSRFKPRV PVIKKCIDIL IEKEYLERVD GEKDTYSYLA. It is sometimes possible for the material contained within the vial of "CUL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.