Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-BUD31 Antibody Titration: 1.25ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)

Rabbit BUD31 Polyclonal Antibody | anti-BUD31 antibody

BUD31 antibody - middle region

Gene Names
BUD31; G10; EDG2; Cwc14; EDG-2; fSAP17; YCR063W
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
BUD31; Polyclonal Antibody; BUD31 antibody - middle region; anti-BUD31 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SRELYEYCIKEGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICR
Sequence Length
144
Applicable Applications for anti-BUD31 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Goat: 92%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human BUD31
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-BUD31 Antibody Titration: 1.25ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-BUD31 Antibody Titration: 1.25ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)
Related Product Information for anti-BUD31 antibody
This is a rabbit polyclonal antibody against BUD31. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: BUD31 may be a nuclear regulator of transcription.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17kDa
NCBI Official Full Name
protein BUD31 homolog
NCBI Official Synonym Full Names
BUD31 homolog
NCBI Official Symbol
BUD31
NCBI Official Synonym Symbols
G10; EDG2; Cwc14; EDG-2; fSAP17; YCR063W
NCBI Protein Information
protein BUD31 homolog
UniProt Protein Name
Protein BUD31 homolog
Protein Family
UniProt Gene Name
BUD31
UniProt Synonym Gene Names
EDG2
UniProt Entry Name
BUD31_HUMAN

Uniprot Description

BUD31: Belongs to the BUD31 (G10) family.

Protein type: Transcription factor; Spliceosome

Chromosomal Location of Human Ortholog: 7q22.1

Cellular Component: spliceosome; nucleus

Molecular Function: transcription factor activity

Biological Process: regulation of transcription from RNA polymerase II promoter; nuclear mRNA splicing, via spliceosome

Research Articles on BUD31

Similar Products

Product Notes

The BUD31 bud31 (Catalog #AAA3204062) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BUD31 antibody - middle region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's BUD31 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the BUD31 bud31 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SRELYEYCIK EGYADKNLIA KWKKQGYENL CCLRCIQTRD TNFGTNCICR. It is sometimes possible for the material contained within the vial of "BUD31, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.