Rabbit anti-Human CRLF1 Polyclonal Antibody | anti-CRLF1 antibody

CRLF1 (Cytokine Receptor-like Factor 1, Cytokine-like Factor 1, CLF-1, ZcytoR5, UNQ288/PRO327) (FITC)

Cat. Num. AAA6374745

• Gene Names: CRLF1; CLF; NR6; CISS; CISS1; CLF-1; zcytor5
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CRLF1; Polyclonal Antibody; CRLF1 (Cytokine Receptor-like Factor 1; Cytokine-like Factor 1; CLF-1; ZcytoR5; UNQ288/PRO327) (FITC); anti-CRLF1 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human CRLF1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
• Sequence Length: 1804

• Applicable Applications for anti-CRLF1 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human CRLF1, aa1-422 (NP_004741.1)
• Immunogen Sequence: MPAGRRGPAAQSARRPPPLLPLLLLLCVLGAPRAGSGAHTAVISPQDPTLLIGSSLLATCSVHGDPPGATAEGLYWTLNGRRLPPELSRVLNASTLALALANLNGSRQRSGDNLVCHARDGSILAGSCLYVGLPPEKPVNISCWSKNMKDLTCRWTPGAHGETFLHTNYSLKYKLRWYGQDNTCEEYHTVGPHSCHIPKDLALFTPYEIWVEATNRLGSARSDVLTLDILDVVTTDPPPDVHVSRVGGLEDQLSVRWVSPPALKDFLFQAKYQIRYRVEDSVDWKVVDDVSNQTSCRLAGLKPGTVYFVQVRCNPFGIYGSKKAGIWSEWSHPTAASTPRSERPGPGGGACEPRGGEPSSGPVRRELKQFLGWLKKHAYCSNLSFRLYDQWRAWMQKSHKTRNQDEGILPSGRRGTARGPAR
• Conjugate: FITC
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CRLF1 expression in transfected 293T cell line by CRLF1 polyclonal antibody. Lane 1: CRLF1 transfected lysate (46.3kD). Lane 2: Non-transfected lysate. )

Related Product Information for anti-CRLF1 antibody

This gene encodes a member of the cytokine type I receptor family. The protein forms a secreted complex with cardiotrophin-like cytokine factor 1 and acts on cells expressing ciliary neurotrophic factor receptors. The complex can promote survival of neuronal cells. Mutations in this gene result in Crisponi syndrome and cold-induced sweating syndrome. [provided by RefSeq].

Product Categories/Family for anti-CRLF1 antibody

Antibodies; Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 21361081
• NCBI GeneID: 9244
• NCBI Accession #: NM_004750.2
• NCBI GenBank Nucleotide #: NM_004750.2
• NCBI Official Full Name: Homo sapiens cytokine receptor-like factor 1 (CRLF1), mRNA
• NCBI Official Synonym Full Names: cytokine receptor like factor 1
• NCBI Official Symbol: CRLF1
• NCBI Official Synonym Symbols: CLF; NR6; CISS; CISS1; CLF-1; zcytor5
• NCBI Protein Information: cytokine receptor-like factor 1
• Protein Family: Cytokine receptor-like factor

NCBI Description

This gene encodes a member of the cytokine type I receptor family. The protein forms a secreted complex with cardiotrophin-like cytokine factor 1 and acts on cells expressing ciliary neurotrophic factor receptors. The complex can promote survival of neuronal cells. Mutations in this gene result in Crisponi syndrome and cold-induced sweating syndrome. [provided by RefSeq, Oct 2009]