Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.3kD).)

Mouse anti-Human CRLF1 Monoclonal Antibody | anti-CRLF1 antibody

CRLF1 (Cytokine Receptor-like Factor 1, Cytokine-like Factor 1, CLF-1, ZcytoR5, UNQ288/PRO327) (FITC)

Gene Names
CRLF1; CLF; NR6; CISS; CISS1; CLF-1; zcytor5
Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CRLF1; Monoclonal Antibody; CRLF1 (Cytokine Receptor-like Factor 1; Cytokine-like Factor 1; CLF-1; ZcytoR5; UNQ288/PRO327) (FITC); anti-CRLF1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4F4
Specificity
Recognizes human CRLF1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
1741
Applicable Applications for anti-CRLF1 antibody
ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa135-230 from CRLF1 (NP_004741) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PEKPVNISCWSKNMKDLTCRWTPGAHGETFLHTNYSLKYKLRWYGQDNTCEEYHTVGPHSCHIPKDLALFTPYEIWVEATNRLGSARSDVLTLDIL
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.3kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.3kD).)

Western Blot (WB)

(CRLF1 Western Blot analysis of CRLF1 expression in HeLa)

Western Blot (WB) (CRLF1 Western Blot analysis of CRLF1 expression in HeLa)

Western Blot (WB)

(Western Blot analysis of CRLF1 expression in transfected 293T cell line by CRLF1 monoclonal antibody. Lane 1: CRLF1 transfected lysate (46.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CRLF1 expression in transfected 293T cell line by CRLF1 monoclonal antibody. Lane 1: CRLF1 transfected lysate (46.3kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of CRLF1 transfected lysate using CRLF1 monoclonal antibody and Protein A Magnetic Bead, immunoblotted with CRLF1 rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of CRLF1 transfected lysate using CRLF1 monoclonal antibody and Protein A Magnetic Bead, immunoblotted with CRLF1 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged CRLF1 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CRLF1 is ~0.03ng/ml as a capture antibody.)
Related Product Information for anti-CRLF1 antibody
This gene encodes a member of the cytokine type I receptor family. The protein forms a secreted complex with cardiotrophin-like cytokine factor 1 and acts on cells expressing ciliary neurotrophic factor receptors. The complex can promote survival of neuronal cells. Mutations in this gene result in Crisponi syndrome and cold-induced sweating syndrome. [provided by RefSeq].
Product Categories/Family for anti-CRLF1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens cytokine receptor like factor 1 (CRLF1), mRNA
NCBI Official Synonym Full Names
cytokine receptor like factor 1
NCBI Official Symbol
CRLF1
NCBI Official Synonym Symbols
CLF; NR6; CISS; CISS1; CLF-1; zcytor5
NCBI Protein Information
cytokine receptor-like factor 1
UniProt Protein Name
Cytokine receptor-like factor 1
UniProt Gene Name
CRLF1
UniProt Synonym Gene Names
CLF-1
UniProt Entry Name
CRLF1_HUMAN

NCBI Description

This gene encodes a member of the cytokine type I receptor family. The protein forms a secreted complex with cardiotrophin-like cytokine factor 1 and acts on cells expressing ciliary neurotrophic factor receptors. The complex can promote survival of neuronal cells. Mutations in this gene result in Crisponi syndrome and cold-induced sweating syndrome. [provided by RefSeq, Oct 2009]

Research Articles on CRLF1

Similar Products

Product Notes

The CRLF1 crlf1 (Catalog #AAA6146661) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CRLF1 (Cytokine Receptor-like Factor 1, Cytokine-like Factor 1, CLF-1, ZcytoR5, UNQ288/PRO327) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CRLF1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CRLF1 crlf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CRLF1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.