Mouse anti-Human CRLF1 Polyclonal Antibody | anti-CRLF1 antibody

CRLF1 (Cytokine Receptor-like Factor 1, Cytokine-like Factor 1, CLF-1, ZcytoR5, UNQ288/PRO327)

Cat. Num. AAA649571

• Gene Names: CRLF1; CLF; NR6; CISS; CISS1; CLF-1; zcytor5
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: CRLF1; Polyclonal Antibody; CRLF1 (Cytokine Receptor-like Factor 1; Cytokine-like Factor 1; CLF-1; ZcytoR5; UNQ288/PRO327); Anti -CRLF1 (Cytokine Receptor-like Factor 1; anti-CRLF1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human CRLF1.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MPAGRRGPAAQSARRPPPLLPLLLLLCVLGAPRAGSGAHTAVISPQDPTLLIGSSLLATCSVHGDPPGATAEGLYWTLNGRRLPPELSRVLNASTLALALANLNGSRQRSGDNLVCHARDGSILAGSCLYVGLPPEKPVNISCWSKNMKDLTCRWTPGAHGETFLHTNYSLKYKLRWYGQDNTCEEYHTVGPHSCHIPKDLALFTPYEIWVEATNRLGSARSDVLTLDILDVVTTDPPPDVHVSRVGGLEDQLSVRWVSPPALKDFLFQAKYQIRYRVEDSVDWKVVDDVSNQTSCRLAGLKPGTVYFVQVRCNPFGIYGSKKAGIWSEWSHPTAASTPRSERPGPGGGACEPRGGEPSSGPVRRELKQFLGWLKKHAYCSNLSFRLYDQWRAWMQKSHKTRNQDEGILPSGRRGTARGPAR

• Applicable Applications for anti-CRLF1 antibody: Western Blot (WB)
• Application Notes: Suitable for use in Western Blot.
• Immunogen: Full length human CRLF1, aa1-422 (NP_004741.1)
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CRLF1 expression in transfected 293T cell line by CRLF1 polyclonal antibody. Lane 1: CRLF1 transfected lysate (46.42kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-CRLF1 antibody

This gene encodes a member of the cytokine type I receptor family. The protein forms a secreted complex with cardiotrophin-like cytokine factor 1 and acts on cells expressing ciliary neurotrophic factor receptors. The complex can promote survival of neuronal cells. Mutations in this gene result in Crisponi syndrome and cold-induced sweating syndrome. [provided by RefSeq].

Product Categories/Family for anti-CRLF1 antibody

Antibodies; Abs to Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 4758062
• NCBI GeneID: 9244
• NCBI Accession #: NP_004741.1
• NCBI GenBank Nucleotide #: NM_004750.4
• UniProt Accession #: O75462; Q9UHH5
• Molecular Weight: 46,302 Da
• NCBI Official Full Name: cytokine receptor-like factor 1
• NCBI Official Synonym Full Names: cytokine receptor-like factor 1
• NCBI Official Symbol: CRLF1
• NCBI Official Synonym Symbols: CLF; NR6; CISS; CISS1; CLF-1; zcytor5
• NCBI Protein Information: cytokine receptor-like factor 1; cytokine-like factor 1; class I cytokine receptor; cytokine type 1 receptor CRLP-1
• UniProt Protein Name: Cytokine receptor-like factor 1
• Protein Family: Cytokine receptor-like factor
• UniProt Gene Name: CRLF1
• UniProt Synonym Gene Names: CLF-1
• UniProt Entry Name: CRLF1_HUMAN

NCBI Description

This gene encodes a member of the cytokine type I receptor family. The protein forms a secreted complex with cardiotrophin-like cytokine factor 1 and acts on cells expressing ciliary neurotrophic factor receptors. The complex can promote survival of neuronal cells. Mutations in this gene result in Crisponi syndrome and cold-induced sweating syndrome. [provided by RefSeq, Oct 2009]

Uniprot Description

Function: Cytokine receptor subunit, possibly playing a regulatory role in the immune system and during fetal development. May be involved in nervous system development.

Subunit structure: Forms covalently linked di- and tetramers. Forms a heteromeric complex with cardiotrophin-like cytokine (CLC); the CRLF1/CLC complex is a ligand for the ciliary neurotrophic factor receptor (CNTFR). Ref.1

Subcellular location: Secreted Ref.1.

Tissue specificity: Highest levels of expression observed in spleen, thymus, lymph node, appendix, bone marrow, stomach, placenta, heart, thyroid and ovary. Strongly expressed also in fetal lung. Ref.1

Induction: Up-regulated in fibroblast primary cell cultures under stimulation by IFNG/IFN-gamma, TNF and IL6/interleukin-6. Ref.1

Domain: The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.

Involvement in disease: Cold-induced sweating syndrome 1 (CISS1) [MIM:272430]: An autosomal recessive disorder characterized by profuse sweating induced by cool surroundings (temperatures of 7 to 18 degrees Celsius). Patients manifest, in the neonatal period, orofacial weakness with impaired sucking and swallowing, resulting in poor feeding. Affected infants show a tendency to startle, with contractions of the facial muscles in response to tactile stimuli or during crying, trismus, abundant salivation, and opisthotonus. These features are referred to as Crisponi syndrome and can result in early death in infancy. Patients who survive into childhood have hyperhidrosis, mainly of the upper body, in response to cold temperatures, and sweat very little with heat. Additional abnormalities include a high-arched palate, nasal voice, depressed nasal bridge, inability to fully extend the elbows and kyphoscoliosis.Note: The disease is caused by mutations affecting the gene represented in this entry. Ref.8 Ref.9

Sequence similarities: Belongs to the type I cytokine receptor family. Type 3 subfamily.Contains 2 fibronectin type-III domains.Contains 1 Ig-like C2-type (immunoglobulin-like) domain.