Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.62kD).)

Mouse anti-Human ZFP36L1 Monoclonal Antibody | anti-ZFP36L1 antibody

ZFP36L1 (Zinc Finger Protein 36, C3H1 Type-like 1, Butyrate Response Factor 1, EGF-response Factor 1, ERF-1, Protein TIS11B, BERG36, BRF1, ERF1, RNF162B, TIS11B) (FITC)

Gene Names
ZFP36L1; BRF1; ERF1; cMG1; ERF-1; Berg36; TIS11B; RNF162B
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ZFP36L1; Monoclonal Antibody; ZFP36L1 (Zinc Finger Protein 36; C3H1 Type-like 1; Butyrate Response Factor 1; EGF-response Factor 1; ERF-1; Protein TIS11B; BERG36; BRF1; ERF1; RNF162B; TIS11B) (FITC); anti-ZFP36L1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1A3
Specificity
Recognizes human ZFP36L1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-ZFP36L1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-108 from human ZFP36L1 (NP_004917) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MTTTLVSATIFDLSEVLCKGNKMLNYSAPSAGGCLLDRKAVGTPAGGGFPRRHSVTLPSSKFHQNQLLSSLKGEPAPALSSRDSRFRDRSFSEGGERLLPTQKQPGGG
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.62kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.62kD).)

Western Blot (WB)

(Western Blot analysis of ZFP36L1 expression in transfected 293T cell line by ZFP36L1 monoclonal antibody. Lane 1: ZFP36L1 transfected lysate (36.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ZFP36L1 expression in transfected 293T cell line by ZFP36L1 monoclonal antibody. Lane 1: ZFP36L1 transfected lysate (36.3kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged ZFP36L1 is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ZFP36L1 is ~1ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of ZFP36L1 over-expressed 293 cell line, cotransfected with ZFP36L1 Validated Chimera RNAi Lane 2) or non-transfected control (Lane 1). Blot probed with ZFP36L1 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of ZFP36L1 over-expressed 293 cell line, cotransfected with ZFP36L1 Validated Chimera RNAi Lane 2) or non-transfected control (Lane 1). Blot probed with ZFP36L1 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)
Related Product Information for anti-ZFP36L1 antibody
Probable regulatory protein involved in regulating the response to growth factors.
Product Categories/Family for anti-ZFP36L1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
677
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
mRNA decay activator protein ZFP36L1 isoform 1
NCBI Official Synonym Full Names
ZFP36 ring finger protein like 1
NCBI Official Symbol
ZFP36L1
NCBI Official Synonym Symbols
BRF1; ERF1; cMG1; ERF-1; Berg36; TIS11B; RNF162B
NCBI Protein Information
mRNA decay activator protein ZFP36L1
UniProt Protein Name
Zinc finger protein 36, C3H1 type-like 1
UniProt Gene Name
ZFP36L1
UniProt Synonym Gene Names
BERG36; BRF1; ERF1; RNF162B; TIS11B; ERF-1
UniProt Entry Name
TISB_HUMAN

NCBI Description

This gene is a member of the TIS11 family of early response genes, which are induced by various agonists such as the phorbol ester TPA and the polypeptide mitogen EGF. This gene is well conserved across species and has a promoter that contains motifs seen in other early-response genes. The encoded protein contains a distinguishing putative zinc finger domain with a repeating cys-his motif. This putative nuclear transcription factor most likely functions in regulating the response to growth factors. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2011]

Uniprot Description

BRF1: a zinc finger protein that plays an important role in the assembly of the RNA polymerase III initiation factor TFIIIB. Regulates mRNA levels by targeting transcripts containing AREs (AU-rich elements) into the decay pathway. Phosphorylation by Akt apparently generates 14-3-3 binding sites and inhibits BRF1 from promoting mRNA activity.Contains 2 C3H1-type zinc fingers.

Protein type: Transcription factor

Chromosomal Location of Human Ortholog: 14q22-q24

Cellular Component: nucleus; cytosol

Molecular Function: mRNA binding; protein binding; DNA binding; metal ion binding; transcription factor activity

Biological Process: regulation of translation; neural tube development; cell proliferation; regulation of transcription, DNA-dependent; apoptosis; heart development; multicellular organism growth; T cell differentiation in the thymus; gene expression; regulation of mRNA stability; vasculogenesis; mRNA catabolic process, deadenylation-dependent decay

Research Articles on ZFP36L1

Similar Products

Product Notes

The ZFP36L1 zfp36l1 (Catalog #AAA6150524) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ZFP36L1 (Zinc Finger Protein 36, C3H1 Type-like 1, Butyrate Response Factor 1, EGF-response Factor 1, ERF-1, Protein TIS11B, BERG36, BRF1, ERF1, RNF162B, TIS11B) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ZFP36L1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ZFP36L1 zfp36l1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ZFP36L1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.