Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CRIP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: THP-1 cell lysate)

Rabbit CRIP1 Polyclonal Antibody | anti-CRIP1 antibody

CRIP1 antibody - middle region

Gene Names
CRIP1; CRHP; CRIP; CRP1; CRP-1
Reactivity
Cow, Dog, Human, Mouse, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CRIP1; Polyclonal Antibody; CRIP1 antibody - middle region; anti-CRIP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Human, Mouse, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYAAMFGPKGFGRGGAESHTF
Sequence Length
77
Applicable Applications for anti-CRIP1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CRIP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CRIP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: THP-1 cell lysate)

Western Blot (WB) (WB Suggested Anti-CRIP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: THP-1 cell lysate)
Related Product Information for anti-CRIP1 antibody
This is a rabbit polyclonal antibody against CRIP1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Cysteine-rich intestinal protein (CRIP) belongs to the LIM/double zinc finger protein family, members of which include cysteine- and glycine-rich protein-1 (CSRP1; MIM 123876), rhombotin-1 (RBTN1; MIM 186921), rhombotin-2 (RBTN2; MIM 180385), and rhombotin-3 (RBTN3; MIM 180386). CRIP may be involved in intestinal zinc transport (Hempe and Cousins, 1991 [PubMed 1946385]).
Product Categories/Family for anti-CRIP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
8kDa
NCBI Official Full Name
cysteine-rich protein 1
NCBI Official Synonym Full Names
cysteine rich protein 1
NCBI Official Symbol
CRIP1
NCBI Official Synonym Symbols
CRHP; CRIP; CRP1; CRP-1
NCBI Protein Information
cysteine-rich protein 1
UniProt Protein Name
Cysteine-rich protein 1
Protein Family
UniProt Gene Name
CRIP1
UniProt Synonym Gene Names
CRIP; CRP1; CRP-1; CRHP; hCRHP; CRIP
UniProt Entry Name
CRIP1_HUMAN

NCBI Description

Cysteine-rich intestinal protein (CRIP) belongs to the LIM/double zinc finger protein family, members of which include cysteine- and glycine-rich protein-1 (CSRP1; MIM 123876), rhombotin-1 (RBTN1; MIM 186921), rhombotin-2 (RBTN2; MIM 180385), and rhombotin-3 (RBTN3; MIM 180386). CRIP may be involved in intestinal zinc transport (Hempe and Cousins, 1991 [PubMed 1946385]).[supplied by OMIM, Mar 2008]

Uniprot Description

CRIP1: a LIM protein which is developmentally regulated in heart. May have a role in zinc absorption and may function as an intracellular zinc transport protein. The CRIP1 gene is hypomethylated in prostate cancer.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 14q32.33

Cellular Component: cytoplasm

Molecular Function: AT DNA binding; zinc ion binding; DNA bending activity; peptide binding

Biological Process: response to organic substance; cell proliferation; DNA damage response, signal transduction resulting in induction of apoptosis; response to zinc ion; regulation of gene expression; heart development; immune response

Research Articles on CRIP1

Similar Products

Product Notes

The CRIP1 crip1 (Catalog #AAA3210344) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CRIP1 antibody - middle region reacts with Cow, Dog, Human, Mouse, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CRIP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CRIP1 crip1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PCLKCEKCGK TLTSGGHAEH EGKPYCNHPC YAAMFGPKGF GRGGAESHTF. It is sometimes possible for the material contained within the vial of "CRIP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.