Rabbit CRIP1 Polyclonal Antibody | anti-CRIP1 antibody

CRIP1 antibody - N-terminal region

Cat. Num. AAA3210343

• Gene Names: CRIP1; CRHP; CRIP; CRP1; CRP-1
• Reactivity: Cow, Dog, Guinea Pig, Human, Mouse, Rat, Zebrafish
• Applications: Western Blot
• Purity: Affinity Purified
• Synonyms: CRIP1; Polyclonal Antibody; CRIP1 antibody - N-terminal region; anti-CRIP1 antibody

• Host: Rabbit
• Reactivity: Cow, Dog, Guinea Pig, Human, Mouse, Rat, Zebrafish
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: MPKCPKCNKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKP
• Sequence Length: 77

• Applicable Applications for anti-CRIP1 antibody: Western Blot (WB)
• Homology: Cow: 100%; Dog: 100%; Guinea Pig: 92%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CRIP1
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-CRIP1 antibodyFormalin Fixed Paraffin Embedded Tissue: Human LiverPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Immunohistochemistry (IHC)

(Rabbit Anti-CRIP1 antibodyFormalin Fixed Paraffin Embedded Tissue: Human PlacentaPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Western Blot (WB)

(WB Suggested Anti-CRIP1 Antibody Titration: 0.2-1 ug/mlPositive Control: PANC1 cell lysateCRIP1 is supported by BioGPS gene expression data to be expressed in PANC1)

Related Product Information for anti-CRIP1 antibody

This is a rabbit polyclonal antibody against CRIP1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Cysteine-rich intestinal protein (CRIP) belongs to the LIM/double zinc finger protein family, members of which include cysteine- and glycine-rich protein-1 (CSRP1; MIM 123876), rhombotin-1 (RBTN1; MIM 186921), rhombotin-2 (RBTN2; MIM 180385), and rhomboti

Product Categories/Family for anti-CRIP1 antibody

Polyclonal; Transcription Factor; Lymphocyte Signaling

NCBI and Uniprot Product Information

• NCBI GI #: 4503047
• NCBI GeneID: 1396
• NCBI Accession #: NP_001302
• NCBI GenBank Nucleotide #: NM_001311
• UniProt Accession #: P50238
• Molecular Weight: 8kDa
• NCBI Official Full Name: cysteine-rich protein 1
• NCBI Official Synonym Full Names: cysteine rich protein 1
• NCBI Official Symbol: CRIP1
• NCBI Official Synonym Symbols: CRHP; CRIP; CRP1; CRP-1
• NCBI Protein Information: cysteine-rich protein 1
• UniProt Protein Name: Cysteine-rich protein 1
• Protein Family: Cysteine-rich protein
• UniProt Gene Name: CRIP1
• UniProt Synonym Gene Names: CRIP; CRP1; CRP-1; CRHP; hCRHP; CRIP
• UniProt Entry Name: CRIP1_HUMAN

NCBI Description

Cysteine-rich intestinal protein (CRIP) belongs to the LIM/double zinc finger protein family, members of which include cysteine- and glycine-rich protein-1 (CSRP1; MIM 123876), rhombotin-1 (RBTN1; MIM 186921), rhombotin-2 (RBTN2; MIM 180385), and rhombotin-3 (RBTN3; MIM 180386). CRIP may be involved in intestinal zinc transport (Hempe and Cousins, 1991 [PubMed 1946385]).[supplied by OMIM, Mar 2008]

Uniprot Description

CRIP1: a LIM protein which is developmentally regulated in heart. May have a role in zinc absorption and may function as an intracellular zinc transport protein. The CRIP1 gene is hypomethylated in prostate cancer.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 14q32.33

Cellular Component: cytoplasm

Molecular Function: AT DNA binding; zinc ion binding; DNA bending activity; peptide binding

Biological Process: response to organic substance; cell proliferation; DNA damage response, signal transduction resulting in induction of apoptosis; response to zinc ion; regulation of gene expression; heart development; immune response