Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: LECT1Sample Tissue: Human 786-0Antibody Dilution: 1.0ug/ml)

Rabbit CNMD Polyclonal Antibody | anti-CNMD antibody

CNMD Antibody - N-terminal region

Gene Names
CNMD; CHM1; CHM-I; LECT1; BRICD3; MYETS1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CNMD; Polyclonal Antibody; CNMD Antibody - N-terminal region; anti-CNMD antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AIAVNDFQNGITGIRFAGGEKCYIKAQVKARIPEVGAVTKQSISSKLEGK
Sequence Length
334
Applicable Applications for anti-CNMD antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 92%; Guinea Pig: 93%; Horse: 92%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human LECT1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: LECT1Sample Tissue: Human 786-0Antibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: LECT1Sample Tissue: Human 786-0Antibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-LECT1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 721_B cell lysateLECT1 is supported by BioGPS gene expression data to be expressed in 721_B)

Western Blot (WB) (WB Suggested Anti-LECT1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: 721_B cell lysateLECT1 is supported by BioGPS gene expression data to be expressed in 721_B)
Related Product Information for anti-CNMD antibody
This is a rabbit polyclonal antibody against LECT1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene encodes a glycosylated transmembrane protein that is cleaved to form a mature, secreted protein. The N-terminus of the precursor protein shares characteristics with other surfactant proteins and is sometimes called chondrosurfactant protein although no biological activity has yet been defined for it. The C-terminus of the precursor protein contains a 25 kDa mature protein called leukocyte cell-derived chemotaxin-1 or chondromodulin-1. The mature protein promotes chondrocyte growth and inhibits angiogenesis. This gene is expressed in the avascular zone of prehypertrophic cartilage and its expression decreases during chondrocyte hypertrophy and vascular invasion. The mature protein likely plays a role in endochondral bone development by permitting cartilaginous anlagen to be vascularized and replaced by bone. It may be involved also in the broad control of tissue vascularization during development. Alternative splicing results in multiple transcript variants encoding different isoforms.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
leukocyte cell-derived chemotaxin 1 isoform 1
NCBI Official Synonym Full Names
chondromodulin
NCBI Official Symbol
CNMD
NCBI Official Synonym Symbols
CHM1; CHM-I; LECT1; BRICD3; MYETS1
NCBI Protein Information
leukocyte cell-derived chemotaxin 1
UniProt Protein Name
Leukocyte cell-derived chemotaxin 1
UniProt Gene Name
LECT1
UniProt Synonym Gene Names
CHMI; CH-SP; ChM-I
UniProt Entry Name
LECT1_HUMAN

NCBI Description

This gene encodes a glycosylated transmembrane protein that is cleaved to form a mature, secreted protein. The N-terminus of the precursor protein shares characteristics with other surfactant proteins and is sometimes called chondrosurfactant protein although no biological activity has yet been defined for it. The C-terminus of the precursor protein contains a 25 kDa mature protein called leukocyte cell-derived chemotaxin-1 or chondromodulin-1. The mature protein promotes chondrocyte growth and inhibits angiogenesis. This gene is expressed in the avascular zone of prehypertrophic cartilage and its expression decreases during chondrocyte hypertrophy and vascular invasion. The mature protein likely plays a role in endochondral bone development by permitting cartilaginous anlagen to be vascularized and replaced by bone. It may be involved also in the broad control of tissue vascularization during development. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

LECT1: Bifunctional growth regulator that stimulates the growth of cultured chondrocytes in the presence of basic fibroblast growth factor (FGF) but inhibits the growth of cultured vascular endothelial cells. May contribute to the rapid growth of cartilage and vascular invasion prior to the replacement of cartilage by bone during endochondral bone development. Inhibits in vitro tube formation and mobilization of endothelial cells. Plays a role as antiangiogenic factor in cardiac valves to suppress neovascularization. Belongs to the chondromodulin-1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell development/differentiation; Membrane protein, integral

Chromosomal Location of Human Ortholog: 13q14.3

Cellular Component: proteinaceous extracellular matrix; integral to membrane; endomembrane system

Biological Process: proteoglycan metabolic process; negative regulation of angiogenesis; negative regulation of vascular endothelial growth factor receptor signaling pathway; cartilage development; negative regulation of endothelial cell proliferation; endothelial cell morphogenesis; skeletal development

Research Articles on CNMD

Similar Products

Product Notes

The CNMD lect1 (Catalog #AAA3207458) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CNMD Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CNMD can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CNMD lect1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AIAVNDFQNG ITGIRFAGGE KCYIKAQVKA RIPEVGAVTK QSISSKLEGK. It is sometimes possible for the material contained within the vial of "CNMD, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.