Rabbit anti-Human LECT1 Polyclonal Antibody | anti-LECT1 antibody

LECT1 (Leukocyte Cell-derived Chemotaxin 1, CHMI, BRICD3, MYETS1) (Biotin)

Cat. Num. AAA6384138

• Gene Names: LECT1; CHM1; CHM-I; BRICD3; MYETS1
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: LECT1; Polyclonal Antibody; LECT1 (Leukocyte Cell-derived Chemotaxin 1; CHMI; BRICD3; MYETS1) (Biotin); anti-LECT1 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human LECT1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-LECT1 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human LECT1, aa1-334 (NP_008946.1).
• Immunogen Sequence: MTENSDKVPIALVGPDDVEFCSPPAYATLTVKPSSPARLLKVGAVVLISGAVLLLFGAIGAFYFWKGSDSHIYNVHYTMSINGKLQDGSMEIDAGNNLETFKMGSGAEEAIAVNDFQNGITGIRFAGGEKCYIKAQVKARIPEVGAVTKQSISSKLEGKIMPVKYEENSLIWVAVDQPVKDNSFLSSKVLELCGDLPIFWLKPTYPKEIQRERREVVRKIVPTTTKRPHSGPRSNPGAGRLNNETRPSVQEDSQAFNPDNPYHQQEGESMTFDPRLDHEGICCIECRRSYTHCQKICEPLGGYYPWPYNYQGCRSACRVIMPCSWWVARILGMV
• Conjugate: Biotin
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of DUS4L expression in transfected 293T cell line by DUS4L polyclonal antibody. Lane 1: DUS4L transfected lysate (35.kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-LECT1 antibody

LECT1 a glycosylated transmembrane protein that is cleaved to form a mature, secreted protein. The N-terminus of the precursor protein shares characteristics with other surfactant proteins and is sometimes called chondrosurfactant protein although no biological activity has yet been defined for it. The C-terminus of the precursor protein contains a 25kD mature protein called leukocyte cell-derived chemotaxin-1 or chondromodulin-1. The mature protein promotes chondrocyte growth and inhibits angiogenesis. This protein is expressed in the avascular zone of prehypertrophic cartilage and its expression decreases during chondrocyte hypertrophy and vascular invasion. The mature protein likely plays a role in endochondral bone development by permitting cartilaginous anlagen to be vascularized and replaced by bone. It may be involved also in the broad control of tissue vascularization during development.

Product Categories/Family for anti-LECT1 antibody

Antibodies; Neuroscience

NCBI and Uniprot Product Information

• NCBI GI #: 5901932
• NCBI GeneID: 11061
• NCBI Accession #: NP_008946.1
• NCBI GenBank Nucleotide #: NM_007015.2
• UniProt Accession #: O75829; Q5TAM4; Q8TAY6; Q9UM18
• Molecular Weight: 37,102 Da
• NCBI Official Full Name: leukocyte cell-derived chemotaxin 1 isoform 1
• NCBI Official Synonym Full Names: leukocyte cell derived chemotaxin 1
• NCBI Official Symbol: LECT1
• NCBI Official Synonym Symbols: CHM1; CHM-I; BRICD3; MYETS1
• NCBI Protein Information: leukocyte cell-derived chemotaxin 1; chondromodulin I; chondromodulin-1; chondromodulin-I; BRICHOS domain containing 3; multiple myeloma tumor suppressor 1
• UniProt Protein Name: Leukocyte cell-derived chemotaxin 1
• Protein Family: Leukocyte cell-derived chemotaxin
• UniProt Gene Name: LECT1
• UniProt Synonym Gene Names: CHMI; CH-SP; ChM-I
• UniProt Entry Name: LECT1_HUMAN

NCBI Description

This gene encodes a glycosylated transmembrane protein that is cleaved to form a mature, secreted protein. The N-terminus of the precursor protein shares characteristics with other surfactant proteins and is sometimes called chondrosurfactant protein although no biological activity has yet been defined for it. The C-terminus of the precursor protein contains a 25 kDa mature protein called leukocyte cell-derived chemotaxin-1 or chondromodulin-1. The mature protein promotes chondrocyte growth and inhibits angiogenesis. This gene is expressed in the avascular zone of prehypertrophic cartilage and its expression decreases during chondrocyte hypertrophy and vascular invasion. The mature protein likely plays a role in endochondral bone development by permitting cartilaginous anlagen to be vascularized and replaced by bone. It may be involved also in the broad control of tissue vascularization during development. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

LECT1: Bifunctional growth regulator that stimulates the growth of cultured chondrocytes in the presence of basic fibroblast growth factor (FGF) but inhibits the growth of cultured vascular endothelial cells. May contribute to the rapid growth of cartilage and vascular invasion prior to the replacement of cartilage by bone during endochondral bone development. Inhibits in vitro tube formation and mobilization of endothelial cells. Plays a role as antiangiogenic factor in cardiac valves to suppress neovascularization. Belongs to the chondromodulin-1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell development/differentiation; Membrane protein, integral

Chromosomal Location of Human Ortholog: 13q14.3

Cellular Component: proteinaceous extracellular matrix; integral to membrane; endomembrane system

Biological Process: proteoglycan metabolic process; negative regulation of angiogenesis; negative regulation of vascular endothelial growth factor receptor signaling pathway; cartilage development; negative regulation of endothelial cell proliferation; endothelial cell morphogenesis; skeletal development