Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of DUS4L expression in transfected 293T cell line by DUS4L polyclonal antibody. Lane 1: DUS4L transfected lysate (35.kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human LECT1 Polyclonal Antibody | anti-LECT1 antibody

LECT1 (Leukocyte Cell-derived Chemotaxin 1, CHMI, BRICD3, MYETS1) (AP)

Gene Names
LECT1; CHM1; CHM-I; BRICD3; MYETS1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
LECT1; Polyclonal Antibody; LECT1 (Leukocyte Cell-derived Chemotaxin 1; CHMI; BRICD3; MYETS1) (AP); anti-LECT1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human LECT1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-LECT1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human LECT1, aa1-334 (NP_008946.1).
Immunogen Sequence
MTENSDKVPIALVGPDDVEFCSPPAYATLTVKPSSPARLLKVGAVVLISGAVLLLFGAIGAFYFWKGSDSHIYNVHYTMSINGKLQDGSMEIDAGNNLETFKMGSGAEEAIAVNDFQNGITGIRFAGGEKCYIKAQVKARIPEVGAVTKQSISSKLEGKIMPVKYEENSLIWVAVDQPVKDNSFLSSKVLELCGDLPIFWLKPTYPKEIQRERREVVRKIVPTTTKRPHSGPRSNPGAGRLNNETRPSVQEDSQAFNPDNPYHQQEGESMTFDPRLDHEGICCIECRRSYTHCQKICEPLGGYYPWPYNYQGCRSACRVIMPCSWWVARILGMV
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of DUS4L expression in transfected 293T cell line by DUS4L polyclonal antibody. Lane 1: DUS4L transfected lysate (35.kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of DUS4L expression in transfected 293T cell line by DUS4L polyclonal antibody. Lane 1: DUS4L transfected lysate (35.kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-LECT1 antibody
LECT1 a glycosylated transmembrane protein that is cleaved to form a mature, secreted protein. The N-terminus of the precursor protein shares characteristics with other surfactant proteins and is sometimes called chondrosurfactant protein although no biological activity has yet been defined for it. The C-terminus of the precursor protein contains a 25kD mature protein called leukocyte cell-derived chemotaxin-1 or chondromodulin-1. The mature protein promotes chondrocyte growth and inhibits angiogenesis. This protein is expressed in the avascular zone of prehypertrophic cartilage and its expression decreases during chondrocyte hypertrophy and vascular invasion. The mature protein likely plays a role in endochondral bone development by permitting cartilaginous anlagen to be vascularized and replaced by bone. It may be involved also in the broad control of tissue vascularization during development.
Product Categories/Family for anti-LECT1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37,102 Da
NCBI Official Full Name
leukocyte cell-derived chemotaxin 1 isoform 1
NCBI Official Synonym Full Names
leukocyte cell derived chemotaxin 1
NCBI Official Symbol
LECT1
NCBI Official Synonym Symbols
CHM1; CHM-I; BRICD3; MYETS1
NCBI Protein Information
leukocyte cell-derived chemotaxin 1; chondromodulin I; chondromodulin-1; chondromodulin-I; BRICHOS domain containing 3; multiple myeloma tumor suppressor 1
UniProt Protein Name
Leukocyte cell-derived chemotaxin 1
UniProt Gene Name
LECT1
UniProt Synonym Gene Names
CHMI; CH-SP; ChM-I
UniProt Entry Name
LECT1_HUMAN

NCBI Description

This gene encodes a glycosylated transmembrane protein that is cleaved to form a mature, secreted protein. The N-terminus of the precursor protein shares characteristics with other surfactant proteins and is sometimes called chondrosurfactant protein although no biological activity has yet been defined for it. The C-terminus of the precursor protein contains a 25 kDa mature protein called leukocyte cell-derived chemotaxin-1 or chondromodulin-1. The mature protein promotes chondrocyte growth and inhibits angiogenesis. This gene is expressed in the avascular zone of prehypertrophic cartilage and its expression decreases during chondrocyte hypertrophy and vascular invasion. The mature protein likely plays a role in endochondral bone development by permitting cartilaginous anlagen to be vascularized and replaced by bone. It may be involved also in the broad control of tissue vascularization during development. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

LECT1: Bifunctional growth regulator that stimulates the growth of cultured chondrocytes in the presence of basic fibroblast growth factor (FGF) but inhibits the growth of cultured vascular endothelial cells. May contribute to the rapid growth of cartilage and vascular invasion prior to the replacement of cartilage by bone during endochondral bone development. Inhibits in vitro tube formation and mobilization of endothelial cells. Plays a role as antiangiogenic factor in cardiac valves to suppress neovascularization. Belongs to the chondromodulin-1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell development/differentiation; Membrane protein, integral

Chromosomal Location of Human Ortholog: 13q14.3

Cellular Component: proteinaceous extracellular matrix; integral to membrane; endomembrane system

Biological Process: proteoglycan metabolic process; negative regulation of angiogenesis; negative regulation of vascular endothelial growth factor receptor signaling pathway; cartilage development; negative regulation of endothelial cell proliferation; endothelial cell morphogenesis; skeletal development

Research Articles on LECT1

Similar Products

Product Notes

The LECT1 lect1 (Catalog #AAA6384136) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LECT1 (Leukocyte Cell-derived Chemotaxin 1, CHMI, BRICD3, MYETS1) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LECT1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the LECT1 lect1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LECT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.