Western Blot (WB)
(WB Suggested Anti-CLNK AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Heart)
Rabbit CLNK Polyclonal Antibody | anti-CLNK antibody
CLNK Antibody - C-terminal region
Gene Names
CLNK; MIST
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CLNK; Polyclonal Antibody; CLNK Antibody - C-terminal region; anti-CLNK antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SRQAVEEAFMKENKDGSFLVRDCSTKSKEEPYVLAVFYENKVYNVKIRFL
Sequence Length
428
Applicable Applications for anti-CLNK antibody
Western Blot (WB)
Homology
Cow: 79%; Dog: 86%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 93%; Pig: 86%; Rabbit: 100%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human CLNK
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-CLNK AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Heart)
Western Blot (WB)
(WB Suggested Anti-CLNK AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Heart)
Related Product Information for anti-CLNK antibody
This is a rabbit polyclonal antibody against CLNK. It was validated on Western Blot
Target Description: MIST is a member of the SLP76 family of adaptors. MIST plays a role in the regulation of immunoreceptor signaling, including PLC-gamma-mediated B cell antigen receptor (BCR) signaling and FC-epsilon R1-mediated mast cell degranulation.
Target Description: MIST is a member of the SLP76 family of adaptors. MIST plays a role in the regulation of immunoreceptor signaling, including PLC-gamma-mediated B cell antigen receptor (BCR) signaling and FC-epsilon R1-mediated mast cell degranulation.
Product Categories/Family for anti-CLNK antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49kDa
NCBI Official Full Name
cytokine-dependent hematopoietic cell linker
NCBI Official Synonym Full Names
cytokine dependent hematopoietic cell linker
NCBI Official Symbol
CLNK
NCBI Official Synonym Symbols
MIST
NCBI Protein Information
cytokine-dependent hematopoietic cell linker
UniProt Protein Name
Cytokine-dependent hematopoietic cell linker
Protein Family
UniProt Gene Name
CLNK
UniProt Synonym Gene Names
MIST
UniProt Entry Name
CLNK_HUMAN
NCBI Description
MIST is a member of the SLP76 family of adaptors (see LCP2, MIM 601603; BLNK, MIM 604515). MIST plays a role in the regulation of immunoreceptor signaling, including PLC-gamma (PLCG1; MIM 172420)-mediated B cell antigen receptor (BCR) signaling and FC-epsilon R1 (see FCER1A, MIM 147140)-mediated mast cell degranulation (Cao et al., 1999 [PubMed 10562326]; Goitsuka et al., 2000, 2001 [PubMed 10744659] [PubMed 11463797]).[supplied by OMIM, Mar 2008]
Research Articles on CLNK
Similar Products
Product Notes
The CLNK clnk (Catalog #AAA3216722) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CLNK Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CLNK can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CLNK clnk for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SRQAVEEAFM KENKDGSFLV RDCSTKSKEE PYVLAVFYEN KVYNVKIRFL. It is sometimes possible for the material contained within the vial of "CLNK, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
