Western Blot (WB)
(WB Suggested Anti-C20orf10 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysate)
Rabbit C20orf10 Polyclonal Antibody | anti-TP53TG5 antibody
C20orf10 antibody - N-terminal region
Gene Names
TP53TG5; CLG01; C20orf10
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
C20orf10; Polyclonal Antibody; C20orf10 antibody - N-terminal region; anti-TP53TG5 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RLRTVLKNLSLLKLLKSSNRRIQELHKLAKRCWHSLLSVPKILRISSGEN
Sequence Length
290
Applicable Applications for anti-TP53TG5 antibody
Western Blot (WB)
Homology
Cow: 79%; Dog: 86%; Guinea Pig: 83%; Human: 100%; Mouse: 93%; Pig: 86%; Rabbit: 79%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human C20orf10
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-C20orf10 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysate)
Western Blot (WB)
(WB Suggested Anti-C20orf10 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysate)
Related Product Information for anti-TP53TG5 antibody
This is a rabbit polyclonal antibody against C20orf10. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: The exact function of C20orf10 remains unknown.
Target Description: The exact function of C20orf10 remains unknown.
Product Categories/Family for anti-TP53TG5 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32kDa
NCBI Official Full Name
TP53-target gene 5 protein
NCBI Official Synonym Full Names
TP53 target 5
NCBI Official Symbol
TP53TG5
NCBI Official Synonym Symbols
CLG01; C20orf10
NCBI Protein Information
TP53-target gene 5 protein
UniProt Protein Name
TP53-target gene 5 protein
Protein Family
UniProt Gene Name
TP53TG5
UniProt Synonym Gene Names
C20orf10
UniProt Entry Name
T53G5_HUMAN
Uniprot Description
Function: May play a significant role in p53/TP53-mediating signaling pathway. Ref.1
Subunit structure: Interacts with p53/TP53. Ref.1
Subcellular location: Cytoplasm. Nucleus. Note: Cell cycle dependent intracellular localization. Ref.1
Tissue specificity: Highly expressed in heart, brain and small intestine. Less abundant in skeletal muscle, spleen, prostate, ovary and colon. A smaller transcript is expressed specifically in the testis. Ref.1
Induction: By p53/TP53, UV irradiation, by hydrogen peroxide treatment or by treatment with a DNA-damaging reagent. Ref.1
Similar Products
Product Notes
The TP53TG5 tp53tg5 (Catalog #AAA3211452) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The C20orf10 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's C20orf10 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TP53TG5 tp53tg5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RLRTVLKNLS LLKLLKSSNR RIQELHKLAK RCWHSLLSVP KILRISSGEN. It is sometimes possible for the material contained within the vial of "C20orf10, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
