Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CHRDL2 AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole cell)

Rabbit CHRDL2 Polyclonal Antibody | anti-CHRDL2 antibody

CHRDL2 Antibody - N-terminal region

Gene Names
CHRDL2; BNF1; CHL2
Reactivity
Human, Mouse, Rat, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CHRDL2; Polyclonal Antibody; CHRDL2 Antibody - N-terminal region; anti-CHRDL2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CTEGQIYCGLTTCPEPGCPAPLPLPDSCCQACKDEASEQSDEEDSVQSLH
Sequence Length
451
Applicable Applications for anti-CHRDL2 antibody
Western Blot (WB)
Homology
Human: 100%; Mouse: 83%; Rat: 75%; Yeast: 90%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human CHRDL2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CHRDL2 AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole cell)

Western Blot (WB) (WB Suggested Anti-CHRDL2 AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole cell)
Related Product Information for anti-CHRDL2 antibody
This is a rabbit polyclonal antibody against CHRDL2. It was validated on Western Blot

Target Description: CHRDL2 is implicated in tumor angiogenesis. CHRDL2 may inhibits BMPs activity by blocking their interaction with their receptors. CHRDL2 has a negative regulator effect on the cartilage formation/regeneration from immature mesenchymal cells, by preventing or reducing the rate of matrix accumulation. CHRDL2 may play a role during myoblast and osteoblast differentiation, and maturation.
Product Categories/Family for anti-CHRDL2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
3kDa
NCBI Official Full Name
chordin-like protein 2 isoform 1
NCBI Official Synonym Full Names
chordin like 2
NCBI Official Symbol
CHRDL2
NCBI Official Synonym Symbols
BNF1; CHL2
NCBI Protein Information
chordin-like protein 2
UniProt Protein Name
Chordin-like protein 2
Protein Family
UniProt Gene Name
CHRDL2
UniProt Synonym Gene Names
BNF1; CHL2; UNQ765/PRO1557; BNF-1
UniProt Entry Name
CRDL2_HUMAN

NCBI Description

This gene encodes a member of the chordin family of proteins. Chordin family members are secreted proteins that share a cysteine-rich pro-collagen repeat domain and associate with members of the transforming growth factor beta superfamily. In vitro assays demonstrate a direct interaction between the encoded protein and human activin A. This gene is expressed in many tissues including osteoblasts, where it is differentially expressed during differentiation. In addition, its expression is upregulated in human osteoarthritic joint cartilage, suggesting a role in adult cartilage regeneration. [provided by RefSeq, Jan 2015]

Uniprot Description

CHRDL2: May inhibit BMPs activity by blocking their interaction with their receptors. Has a negative regulator effect on the cartilage formation/regeneration from immature mesenchymal cells, by preventing or reducing the rate of matrix accumulation. Implicated in tumor angiogenesis. May play a role during myoblast and osteoblast differentiation, and maturation. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 11q14

Cellular Component: extracellular space; cytoplasm

Biological Process: ossification; cartilage development; cell differentiation; negative regulation of BMP signaling pathway

Research Articles on CHRDL2

Similar Products

Product Notes

The CHRDL2 chrdl2 (Catalog #AAA3216981) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CHRDL2 Antibody - N-terminal region reacts with Human, Mouse, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's CHRDL2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CHRDL2 chrdl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CTEGQIYCGL TTCPEPGCPA PLPLPDSCCQ ACKDEASEQS DEEDSVQSLH. It is sometimes possible for the material contained within the vial of "CHRDL2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.