Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-Fgf9 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Lung)

Rabbit Fgf9 Polyclonal Antibody | anti-FGF9 antibody

Fgf9 Antibody - N-terminal region

Gene Names
Fgf9; Eks
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Fgf9; Polyclonal Antibody; Fgf9 Antibody - N-terminal region; anti-FGF9 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFIS
Sequence Length
208
Applicable Applications for anti-FGF9 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 79%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Fgf9
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-Fgf9 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Lung)

Western Blot (WB) (WB Suggested Anti-Fgf9 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Lung)
Related Product Information for anti-FGF9 antibody
This is a rabbit polyclonal antibody against Fgf9. It was validated on Western Blot

Target Description: Fgf9 plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. May have a role in glial cell growth and differentiation during development, gliosis during repair and regeneration of brain tissue after damage, differentiation and survival of neuronal cells, and growth stimulation of glial tumors.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
fibroblast growth factor 9
NCBI Official Synonym Full Names
fibroblast growth factor 9
NCBI Official Symbol
Fgf9
NCBI Official Synonym Symbols
Eks
NCBI Protein Information
fibroblast growth factor 9
UniProt Protein Name
Fibroblast growth factor 9
Protein Family
UniProt Gene Name
Fgf9
UniProt Synonym Gene Names
Fgf-9; FGF-9; GAF
UniProt Entry Name
FGF9_MOUSE

Uniprot Description

FGF9: Plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. May have a role in glial cell growth and differentiation during development, gliosis during repair and regeneration of brain tissue after damage, differentiation and survival of neuronal cells, and growth stimulation of glial tumors. Defects in FGF9 are the cause of multiple synostoses syndrome type 3 (SYNS3). Multiple synostoses syndrome is an autosomal dominant condition characterized by progressive joint fusions of the fingers, wrists, ankles and cervical spine, characteristic facies and progressive conductive deafness. Belongs to the heparin-binding growth factors family.

Protein type: Cytokine

Cellular Component: extracellular space; cell; cytoplasm; extracellular region; basement membrane; intracellular

Molecular Function: heparin binding; growth factor activity; fibroblast growth factor receptor binding; receptor binding

Biological Process: negative regulation of Wnt receptor signaling pathway; positive regulation of transcription, DNA-dependent; multicellular organismal development; embryonic skeletal development; negative regulation of transcription from RNA polymerase II promoter; positive regulation of vascular endothelial growth factor receptor signaling pathway; positive regulation of activin receptor signaling pathway; positive regulation of MAPKKK cascade; cell-cell signaling; protein import into nucleus; male sex determination; positive regulation of cell proliferation; positive regulation of mesenchymal cell proliferation; positive regulation of smoothened signaling pathway; chondrocyte differentiation; angiogenesis; cell differentiation; regulation of timing of cell differentiation; embryonic gut development; positive regulation of cardiac muscle cell proliferation; embryonic limb morphogenesis; inner ear morphogenesis; fibroblast growth factor receptor signaling pathway; male gonad development; osteoblast differentiation; positive regulation of cell division; positive regulation of epithelial cell proliferation; lung development

Research Articles on FGF9

Similar Products

Product Notes

The FGF9 fgf9 (Catalog #AAA3211762) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Fgf9 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Fgf9 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FGF9 fgf9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AVTDLDHLKG ILRRRQLYCR TGFHLEIFPN GTIQGTRKDH SRFGILEFIS. It is sometimes possible for the material contained within the vial of "Fgf9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.